Recombinant Human CLDND1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : CLDND1-4162H
Product Overview : CLDND1 MS Standard C13 and N15-labeled recombinant protein (NP_063948) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : CLDND1 (Claudin Domain Containing 1) is a Protein Coding gene. Diseases associated with CLDND1 include Renal Cell Carcinoma, Nonpapillary and Breast Cancer.
Molecular Mass : 28.6 kDa
AA Sequence : MDNRFATAFVIACVLSLISTIYMAASIGTDFWYEYRSPVQENSSDLNKSIWDEFISDEADEKTYNDALFRYNGTVGLWRRCITIPKNMHWYSPPERTESFDVVTKCVSFTLTEQFMEKFVDPGNHNSGIDLLRTYLWRCQFLLPFVSLGLMCFGALIGLCACICRSLYPTIATGILHLLAGLCTLGSVSCYVAGIELLHQKLELPDNVSGEFGWSFCLACVSAPLQFMASALFIWAAHTNRKEYTLMKAYRVATRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name CLDND1 claudin domain containing 1 [ Homo sapiens (human) ]
Official Symbol CLDND1
Synonyms CLDND1; claudin domain containing 1; C3orf4, chromosome 3 open reading frame 4; claudin domain-containing protein 1; membrane protein GENX-3745; claudin domain containing 1 protein; C3orf4; GENX-3745; MGC3316; MGC9861; MGC111162;
Gene ID 56650
mRNA Refseq NM_019895
Protein Refseq NP_063948
UniProt ID Q9NY35

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CLDND1 Products

Required fields are marked with *

My Review for All CLDND1 Products

Required fields are marked with *

0
cart-icon