Recombinant Human CLDND1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | CLDND1-4162H |
Product Overview : | CLDND1 MS Standard C13 and N15-labeled recombinant protein (NP_063948) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | CLDND1 (Claudin Domain Containing 1) is a Protein Coding gene. Diseases associated with CLDND1 include Renal Cell Carcinoma, Nonpapillary and Breast Cancer. |
Molecular Mass : | 28.6 kDa |
AA Sequence : | MDNRFATAFVIACVLSLISTIYMAASIGTDFWYEYRSPVQENSSDLNKSIWDEFISDEADEKTYNDALFRYNGTVGLWRRCITIPKNMHWYSPPERTESFDVVTKCVSFTLTEQFMEKFVDPGNHNSGIDLLRTYLWRCQFLLPFVSLGLMCFGALIGLCACICRSLYPTIATGILHLLAGLCTLGSVSCYVAGIELLHQKLELPDNVSGEFGWSFCLACVSAPLQFMASALFIWAAHTNRKEYTLMKAYRVATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | CLDND1 claudin domain containing 1 [ Homo sapiens (human) ] |
Official Symbol | CLDND1 |
Synonyms | CLDND1; claudin domain containing 1; C3orf4, chromosome 3 open reading frame 4; claudin domain-containing protein 1; membrane protein GENX-3745; claudin domain containing 1 protein; C3orf4; GENX-3745; MGC3316; MGC9861; MGC111162; |
Gene ID | 56650 |
mRNA Refseq | NM_019895 |
Protein Refseq | NP_063948 |
UniProt ID | Q9NY35 |
◆ Recombinant Proteins | ||
RFL17171PF | Recombinant Full Length Pongo Abelii Claudin Domain-Containing Protein 1(Cldnd1) Protein, His-Tagged | +Inquiry |
CLDND1-2046C | Recombinant Chicken CLDND1 | +Inquiry |
CLDND1-4162H | Recombinant Human CLDND1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CLDND1-725R | Recombinant Rhesus Macaque CLDND1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CLDND1-900R | Recombinant Rhesus monkey CLDND1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLDND1-7455HCL | Recombinant Human CLDND1 293 Cell Lysate | +Inquiry |
CLDND1-7456HCL | Recombinant Human CLDND1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLDND1 Products
Required fields are marked with *
My Review for All CLDND1 Products
Required fields are marked with *