Recombinant Full Length Human Claudin Domain-Containing Protein 1(Cldnd1) Protein, His-Tagged
Cat.No. : | RFL29537HF |
Product Overview : | Recombinant Full Length Human Claudin domain-containing protein 1(CLDND1) Protein (Q9NY35) (1-253aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-253) |
Form : | Lyophilized powder |
AA Sequence : | MDNRFATAFVIACVLSLISTIYMAASIGTDFWYEYRSPVQENSSDLNKSIWDEFISDEAD EKTYNDALFRYNGTVGLWRRCITIPKNMHWYSPPERTESFDVVTKCVSFTLTEQFMEKFV DPGNHNSGIDLLRTYLWRCQFLLPFVSLGLMCFGALIGLCACICRSLYPTIATGILHLLA GLCTLGSVSCYVAGIELLHQKLELPDNVSGEFGWSFCLACVSAPLQFMASALFIWAAHTN RKEYTLMKAYRVA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CLDND1 |
Synonyms | CLDND1; C3orf4; HSPC174; PSEC0054; UNQ2511/PRO6000; Claudin domain-containing protein 1; Membrane protein GENX-3745 |
UniProt ID | Q9NY35 |
◆ Recombinant Proteins | ||
RFL29537HF | Recombinant Full Length Human Claudin Domain-Containing Protein 1(Cldnd1) Protein, His-Tagged | +Inquiry |
CLDND1-725R | Recombinant Rhesus Macaque CLDND1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CLDND1-4162H | Recombinant Human CLDND1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CLDND1-2046C | Recombinant Chicken CLDND1 | +Inquiry |
CLDND1-11302H | Recombinant Human CLDND1, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLDND1-7455HCL | Recombinant Human CLDND1 293 Cell Lysate | +Inquiry |
CLDND1-7456HCL | Recombinant Human CLDND1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLDND1 Products
Required fields are marked with *
My Review for All CLDND1 Products
Required fields are marked with *