Recombinant Human CLDND2 Protein, GST-tagged
| Cat.No. : | CLDND2-4324H |
| Product Overview : | Human MGC33839 full-length ORF ( NP_689566.1, 1 a.a. - 167 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | CLDND2 (Claudin Domain Containing 2) is a Protein Coding gene. An important paralog of this gene is ENSG00000269403. |
| Molecular Mass : | 44.4 kDa |
| AA Sequence : | MGVKRSLQSGGILLSLVANVLMVLSTATNYWTRQQEGHSGLWQECNHGICSSIPCQTTLAVTVACMVLAVGVGVVGMVMGLRIRCDEGESLRGQTTSAFLFLGGLLLLTALIGYTVKNAWKNNVFFSWSYFSGWLALPFSILAGFCFLLADMIMQSTDAISGFPVCL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CLDND2 claudin domain containing 2 [ Homo sapiens ] |
| Official Symbol | CLDND2 |
| Synonyms | CLDND2; claudin domain containing 2; claudin domain-containing protein 2; MGC33839; |
| Gene ID | 125875 |
| mRNA Refseq | NM_152353 |
| Protein Refseq | NP_689566 |
| UniProt ID | Q8NHS1 |
| ◆ Cell & Tissue Lysates | ||
| CLDND2-7454HCL | Recombinant Human CLDND2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLDND2 Products
Required fields are marked with *
My Review for All CLDND2 Products
Required fields are marked with *
