Recombinant Human CLDND2 Protein, GST-tagged

Cat.No. : CLDND2-4324H
Product Overview : Human MGC33839 full-length ORF ( NP_689566.1, 1 a.a. - 167 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : CLDND2 (Claudin Domain Containing 2) is a Protein Coding gene. An important paralog of this gene is ENSG00000269403.
Molecular Mass : 44.4 kDa
AA Sequence : MGVKRSLQSGGILLSLVANVLMVLSTATNYWTRQQEGHSGLWQECNHGICSSIPCQTTLAVTVACMVLAVGVGVVGMVMGLRIRCDEGESLRGQTTSAFLFLGGLLLLTALIGYTVKNAWKNNVFFSWSYFSGWLALPFSILAGFCFLLADMIMQSTDAISGFPVCL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CLDND2 claudin domain containing 2 [ Homo sapiens ]
Official Symbol CLDND2
Synonyms CLDND2; claudin domain containing 2; claudin domain-containing protein 2; MGC33839;
Gene ID 125875
mRNA Refseq NM_152353
Protein Refseq NP_689566
UniProt ID Q8NHS1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CLDND2 Products

Required fields are marked with *

My Review for All CLDND2 Products

Required fields are marked with *

0
cart-icon