Recombinant Human CLEC10A Protein, GST-tagged
| Cat.No. : | CLEC10A-1451H |
| Product Overview : | Human CLEC10A full-length ORF ( AAH39011, 1 a.a. - 316 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. The encoded type 2 transmembrane protein may function as a cell surface antigen. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 60.5 kDa |
| AA Sequence : | MTRTYENFQYLENKVKVQGFKNGPLPLQSLLQRLCSGPCHLLLSLGLGLLLLVIICVVGFQNSKFQRDLVTLRTDFSNFTSNTVAEIQALTSQGSSLEETIASLKAEVEGFKQERQAGVSELQEHTTQKAHLGHCPHCPSVCVPVHSEMLLRVQQLVQDLKKLTCQVATLNNNASTEGTCCPVNWVEHQDSCYWFSHSGMSWAEAEKYCQLKNAHLVVINSREEQNFVQKYLGSAYTWMGLSDPEGAWKWVDGTDYATGFQNWKPGQPDDWQGHGLGGGEDCAHFHPDGRWNDDVCQRPYHWVCEAGLGQTSQESH |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CLEC10A C-type lectin domain family 10, member A [ Homo sapiens ] |
| Official Symbol | CLEC10A |
| Synonyms | CLEC10A; C-type lectin domain family 10, member A; C type (calcium dependent, carbohydrate recognition domain) lectin, superfamily member 14 (macrophage derived) , CLECSF13, CLECSF14; C-type lectin domain family 10 member A; CD301; HML; HML2; macrophage lectin 2 (calcium dependent); C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 13 (macrophage-derived); C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 14 (macrophage-derived); MGL; CLECSF13; CLECSF14; |
| Gene ID | 10462 |
| mRNA Refseq | NM_006344 |
| Protein Refseq | NP_006335 |
| MIM | 605999 |
| UniProt ID | Q8IUN9 |
| ◆ Recombinant Proteins | ||
| Clec10a-6909M | Recombinant Mouse Clec10a protein(Gln58-Ser305), His-tagged | +Inquiry |
| CLEC10A-2681H | Recombinant Human CLEC10A Protein, His (Fc)-Avi-tagged | +Inquiry |
| CLEC10A-0935H | Recombinant Human CLEC10A Protein (Thr71-Met239), N-His tagged | +Inquiry |
| CLEC10A-1856H | Recombinant Human CLEC10A protein, His & T7-tagged | +Inquiry |
| CLEC10A-5743H | Recombinant Human CLEC10A protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CLEC10A-1730MCL | Recombinant Mouse CLEC10A cell lysate | +Inquiry |
| CLEC10A-1456HCL | Recombinant Human CLEC10A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLEC10A Products
Required fields are marked with *
My Review for All CLEC10A Products
Required fields are marked with *
