Recombinant Human CLEC10A protein, His-tagged
Cat.No. : | CLEC10A-3684H |
Product Overview : | Recombinant Human CLEC10A protein(66 - 316 aa), fused to His tag, was expressed in E. coli. |
Availability | August 16, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 66 - 316 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | QRDLVTLRTDFSNFTSNTVAEIQALTSQGSSLEETIASLKAEVEGFKQERQAGVSELQEHTTQKAHLGHCPHCPSVCVPVHSEMLLRVQQLVQDLKKLTCQVATLNNNASTEGTCCPVNWVEHQDSCYWFSHSGMSWAEAEKYCQLKNAHLVVINSREEQNFVQKYLGSAYTWMGLSDPEGAWKWVDGTDYATGFQNWKPGQPDDWQGHGLGGGEDCAHFHPDGRWNDDVCQRPYHWVCEAGLGQTSQESH |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | CLEC10A C-type lectin domain family 10, member A [ Homo sapiens ] |
Official Symbol | CLEC10A |
Synonyms | CLEC10A; C-type lectin domain family 10, member A; C type (calcium dependent, carbohydrate recognition domain) lectin, superfamily member 14 (macrophage derived) , CLECSF13, CLECSF14; C-type lectin domain family 10 member A; CD301; HML; HML2; macrophage lectin 2 (calcium dependent); C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 13 (macrophage-derived); C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 14 (macrophage-derived); MGL; CLECSF13; CLECSF14; |
Gene ID | 10462 |
mRNA Refseq | NM_006344 |
Protein Refseq | NP_006335 |
MIM | 605999 |
UniProt ID | Q8IUN9 |
◆ Recombinant Proteins | ||
CLEC10A-2112HF | Recombinant Full Length Human CLEC10A Protein | +Inquiry |
CLEC10A-3684H | Recombinant Human CLEC10A protein, His-tagged | +Inquiry |
Clec10a-6908M | Recombinant Mouse Clec10a protein(Gln58-Ser305), hFc-tagged | +Inquiry |
CLEC10A-308H | Recombinant Human CLEC10A protein, His-tagged | +Inquiry |
CLEC10A-7800H | Recombinant Human CLEC10A, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLEC10A-1730MCL | Recombinant Mouse CLEC10A cell lysate | +Inquiry |
CLEC10A-1456HCL | Recombinant Human CLEC10A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLEC10A Products
Required fields are marked with *
My Review for All CLEC10A Products
Required fields are marked with *