Recombinant Human CLEC10A Protein, His-tagged
Cat.No. : | CLEC10A-009H |
Product Overview : | Recombinant Human CLEC10A Protein with His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | Probable role in regulating adaptive and innate immune responses. Binds in a calcium-dependent manner to terminal galactose and N-acetylgalactosamine units, linked to serine or threonine. These sugar moieties are known as Tn-Ag and are expressed in a variety of carcinoma cells. |
Molecular Mass : | ~30 kDa |
AA Sequence : | QNSKFQRDLVTLRTDFSNFTSNTVAEIQALTSQGSSLEETIASLKAEVEGFKQERQAGVSELQEHTTQKAHLGHCPHCPSVCVPVHSEMLLRVQQLVQDLKKLTCQVATLNNNASTEGTCCPVNWVEHQDSCYWFSHSGMSWAEAEKYCQLKNAHLVVINSREEQNFVQKYLGSAYTWMGLSDPEGAWKWVDGTDYATGFQNWKPGQPDDWQGHGLGGGEDCAHFHPDGRWNDDVCQRPYHWVCEAGLGQTSQESH |
Purity : | Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
Notes : | For research use only, not for use in diagnostic procedure. |
Storage : | Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
Storage Buffer : | PBS, 4M Urea, pH7.4 |
Gene Name | CLEC10A C-type lectin domain family 10, member A [ Homo sapiens (human) ] |
Official Symbol | CLEC10A |
Synonyms | CLEC10A; C-type lectin domain family 10, member A; C type (calcium dependent, carbohydrate recognition domain) lectin, superfamily member 14 (macrophage derived) , CLECSF13, CLECSF14; C-type lectin domain family 10 member A; CD301; HML; HML2; macrophage lectin 2 (calcium dependent); C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 13 (macrophage-derived); C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 14 (macrophage-derived); MGL; CLECSF13; CLECSF14; |
Gene ID | 10462 |
mRNA Refseq | NM_006344 |
Protein Refseq | NP_006335 |
MIM | 605999 |
UniProt ID | Q8IUN9 |
◆ Recombinant Proteins | ||
CLEC10A-308H | Recombinant Human CLEC10A protein, His-tagged | +Inquiry |
Clec10a-6908M | Recombinant Mouse Clec10a protein(Gln58-Ser305), hFc-tagged | +Inquiry |
CLEC10A-5743H | Recombinant Human CLEC10A protein, His-tagged | +Inquiry |
Clec10a-307M | Active Recombinant Mouse Clec10a, His-tagged | +Inquiry |
CLEC10A-2681H | Recombinant Human CLEC10A Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLEC10A-1730MCL | Recombinant Mouse CLEC10A cell lysate | +Inquiry |
CLEC10A-1456HCL | Recombinant Human CLEC10A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLEC10A Products
Required fields are marked with *
My Review for All CLEC10A Products
Required fields are marked with *