Recombinant Human CLEC10A Protein, MYC/DDK-tagged, C13 and N15-labeled

Cat.No. : CLEC10A-306H
Product Overview : CLEC10A MS Standard C13 and N15-labeled recombinant protein (NP_006335) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. The encoded type 2 transmembrane protein may function as a cell surface antigen. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jul 2008]
Molecular Mass : 32.7 kDa
AA Sequence : MTRTYENFQYLENKVKVQGFKNGPLPLQSLLQRLCSGPCHLLLSLGLGLLLLVIICVVGFQNSKFQRDLVTLRTDFSNFTSNTVAEIQALTSQGSSLEETIASLKAEVEGFKQERQAVHSEMLLRVQQLVQDLKKLTCQVATLNNNGEEASTEGTCCPVNWVEHQDSCYWFSHSGMSWAEAEKYCQLKNAHLVVINSREEQNFVQKYLGSAYTWMGLSDPEGAWKWVDGTDYATGFQNWKPGQPDDWQGHGLGGGEDCAHFHPDGRWNDDVCQRPYHWVCEAGLGQTSQESHTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name CLEC10A C-type lectin domain family 10, member A [ Homo sapiens (human) ]
Official Symbol CLEC10A
Synonyms CLEC10A; C-type lectin domain family 10, member A; C type (calcium dependent, carbohydrate recognition domain) lectin, superfamily member 14 (macrophage derived), CLECSF13, CLECSF14; C-type lectin domain family 10 member A; CD301; HML; HML2; macrophage lectin 2 (calcium dependent); C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 13 (macrophage-derived); C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 14 (macrophage-derived); MGL; CLECSF13; CLECSF14;
Gene ID 10462
mRNA Refseq NM_006344
Protein Refseq NP_006335
MIM 605999
UniProt ID Q8IUN9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CLEC10A Products

Required fields are marked with *

My Review for All CLEC10A Products

Required fields are marked with *

0
cart-icon