Recombinant Human CLEC12B protein, His-tagged
Cat.No. : | CLEC12B-362H |
Product Overview : | Recombinant Human CLEC12B protein(65-232 aa), fused with His tag, was expressed in E.coli. |
Availability | April 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 65-232 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | LQISNDINSDSEKLSQLQKTIQQQQDNLSQQLGNSNNLSMEEEFLKSQISSLLKRQEQMAIKLCQELIIHTSDHRCNPCPKMWQWYQNSCYYFTTNEEKTWANSRKDCIDKNSTLVKIDSLEEKDFLMSQPLLMFSFFWLGLSWDSSGRSWFWEDGSVPSPSLYVSNY |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | CLEC12B C-type lectin domain family 12, member B [ Homo sapiens ] |
Official Symbol | CLEC12B |
Synonyms | CLEC12B; C-type lectin domain family 12, member B; C-type lectin domain family 12 member B; macrophage antigen h; UNQ5782; |
Gene ID | 387837 |
mRNA Refseq | NM_001129998 |
Protein Refseq | NP_001123470 |
UniProt ID | Q2HXU8 |
◆ Recombinant Proteins | ||
CLEC12B-01H | Active Recombinant human CLEC12B protein, Fc-tagged | +Inquiry |
CLEC12B-726R | Recombinant Rhesus Macaque CLEC12B Protein, His (Fc)-Avi-tagged | +Inquiry |
CLEC12B-362H | Recombinant Human CLEC12B protein, His-tagged | +Inquiry |
Clec12b-2183M | Recombinant Mouse Clec12b Protein, Myc/DDK-tagged | +Inquiry |
CLEC12B-1740M | Recombinant Mouse CLEC12B Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CLEC12B Products
Required fields are marked with *
My Review for All CLEC12B Products
Required fields are marked with *
0
Inquiry Basket