Recombinant Human CLEC12B protein, His-tagged
| Cat.No. : | CLEC12B-362H |
| Product Overview : | Recombinant Human CLEC12B protein(65-232 aa), fused with His tag, was expressed in E.coli. |
| Availability | December 17, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 65-232 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | LQISNDINSDSEKLSQLQKTIQQQQDNLSQQLGNSNNLSMEEEFLKSQISSLLKRQEQMAIKLCQELIIHTSDHRCNPCPKMWQWYQNSCYYFTTNEEKTWANSRKDCIDKNSTLVKIDSLEEKDFLMSQPLLMFSFFWLGLSWDSSGRSWFWEDGSVPSPSLYVSNY |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | CLEC12B C-type lectin domain family 12, member B [ Homo sapiens ] |
| Official Symbol | CLEC12B |
| Synonyms | CLEC12B; C-type lectin domain family 12, member B; C-type lectin domain family 12 member B; macrophage antigen h; UNQ5782; |
| Gene ID | 387837 |
| mRNA Refseq | NM_001129998 |
| Protein Refseq | NP_001123470 |
| UniProt ID | Q2HXU8 |
| ◆ Recombinant Proteins | ||
| CLEC12B-01H | Active Recombinant human CLEC12B protein, Fc-tagged | +Inquiry |
| CLEC12B-362H | Recombinant Human CLEC12B protein, His-tagged | +Inquiry |
| Clec12b-2183M | Recombinant Mouse Clec12b Protein, Myc/DDK-tagged | +Inquiry |
| CLEC12B-3448H | Recombinant Human CLEC12B Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| CLEC12B-4464HFL | Recombinant Full Length Human CLEC12B protein, Flag-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLEC12B Products
Required fields are marked with *
My Review for All CLEC12B Products
Required fields are marked with *
