"CLEC12B" Related Products

Recombinant Human CLEC12B protein, His-tagged

Cat.No.: CLEC12B-362H
Product Overview: Recombinant Human CLEC12B(65-232aa) fused with His tag at N-terminal was expressed in E. coli.
Description: CLEC12B played an important role in many functions.
Source: E. coli
Species: Human
Tag: His
Form: Protein lyophilized in sterile PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, 300 mM Imidazole, pH 8.0). Trehalose (5-8%) and mannitol (5-8%) protectants were added before lyophilization.
AA Sequence: LQISNDINSDSEKLSQLQKTIQQQQDNLSQQLGNSNNLSMEEEFLKSQISSLLKRQEQMAIKLCQELIIHTSDHR CNPCPKMWQWYQNSCYYFTTNEEKTWANSRKDCIDKNSTLVKIDSLEEKDFLMSQPLLMFSFFWLGLSWDSSGRS WFWEDGSVPSPSLYVSNY
Purity: > 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability: Store for up to 12 months at -20 centigradeto -80 centigradeas lyophilized powder.
Storage: Storage of Reconstituted Protein:Short-term storage: Store at 2-8 centigradefor two weeks.Long-term storage: Aliquot and store at -20 centigradeto -80 centigradefor up to 6 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details).If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used).Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution.
Gene Name: CLEC12B C-type lectin domain family 12, member B [ Homo sapiens ]
Official Symbol: CLEC12B
Synonyms: CLEC12B; C-type lectin domain family 12, member B; C-type lectin domain family 12 member B; macrophage antigen h; UNQ5782;
Gene ID: 387837
mRNA Refseq: NM_001129998
Protein Refseq: NP_001123470
MIM:
UniProt ID: Q2HXU8
Chromosome Location: 12p13.2
Function: binding; receptor activity; sugar binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.