Recombinant Human CLEC14A protein, T7/His-tagged
Cat.No. : | CLEC14A-56H |
Product Overview : | Recombinant human CLEC14A cDNA (22 – 398 aa, derived from BC031567) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Protein Length : | 22-398 a.a. |
Form : | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
AA Sequence : | MASMTGGQQMGRGHHHHHHENLYFQGGEFEHPTADRAGCSASGACYSLHHATMKRQAAEEACILRGGALSTVRAG AELRAVLALLRAGPGPGGGSKDLLFWVALERRRSHCTLENEPLRGFSWLSSDPGGLESDTLQWVEEPQRSCTARR CAVLQATGGVEPAGWKEMRCHLRANGYLCKYQFEVLCPAPRPGAASNLSYRAPFQLHSAALDFSPPGTEVSALCR GQLPISVTCIADEIGARWDKLSGDVLCPCPGRYLRAGKCAELPNCLDDLGGFACECATGFELGKDGRSCVTSGEG QPTLGGTGVPTRRPPATATSPVPQRTWPIRVDEKLGETPLVPEQDNSVTSIPEIPRWGSQSTMSTLQMSLQAESK ATITPSGSVISKFNSTTSSATPQAFDSSSAV |
Purity : | >90% by SDS-PAGE |
Applications : | 1. May be used for in vitro CLEC14A protein mediated tumor endothelial cell formation regulation study with this protein as either coating matrix protein or as soluble factor.2. May be used for CLEC14A protein – protein interaction assay.3. May be used as enzymatic substrate for various proteases.4. May be used for specific antibody production. |
Storage : | Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days. |
Gene Name | CLEC14A C-type lectin domain family 14, member A [ Homo sapiens ] |
Official Symbol | CLEC14A |
Synonyms | CLEC14A; C-type lectin domain family 14, member A; C14orf27, chromosome 14 open reading frame 27; C-type lectin domain family 14 member A; epidermal growth factor receptor 5; ClECT and EGF-like domain containing protein; CEG1; EGFR-5; C14orf27; |
Gene ID | 161198 |
mRNA Refseq | NM_175060 |
Protein Refseq | NP_778230 |
MIM | |
UniProt ID | Q86T13 |
Chromosome Location | 14q21.1 |
Function | binding; sugar binding; |
◆ Recombinant Proteins | ||
Clec14a-2285M | Recombinant Mouse Clec14a protein(Met1-Thr386), His-tagged | +Inquiry |
CLEC14A-10174Z | Recombinant Zebrafish CLEC14A | +Inquiry |
Clec14a-15R | Recombinant Rat Clec14a protein(Met1-Thr398), hFc-tagged | +Inquiry |
CLEC14A-1457H | Recombinant Human CLEC14A Protein, GST-tagged | +Inquiry |
CLEC14A-1600H | Recombinant Human CLEC14A protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLEC14A-2579MCL | Recombinant Mouse CLEC14A cell lysate | +Inquiry |
CLEC14A-1138RCL | Recombinant Rat CLEC14A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLEC14A Products
Required fields are marked with *
My Review for All CLEC14A Products
Required fields are marked with *