Recombinant Human CLEC18C Protein, GST-tagged
| Cat.No. : | CLEC18C-5271H |
| Product Overview : | Human MGC34761 full-length ORF ( AAH39068.1, 1 a.a. - 301 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | CLEC18C (C-Type Lectin Domain Family 18 Member C) is a Protein Coding gene. Diseases associated with CLEC18C include Atypical Lipomatous Tumor. Among its related pathways are Sertoli-Sertoli Cell Junction Dynamics and Actin Nucleation by ARP-WASP Complex. GO annotations related to this gene include carbohydrate binding. An important paralog of this gene is CLEC18A. |
| Molecular Mass : | 59.5 kDa |
| AA Sequence : | MAGALNRKESFLLLSLHNRLRSWVQPPAADRRRLDWSDSLAQLAQARAALCGIPTPSLASGLWRTLQVGWNMQLLPAGLASFVEVVSLWFAEGQRYSHAAGECARNATCTHYTQLVWATSSQLGCGRHLCSAGQAAIEAFVCAYSPRGNWEVNGKTIVPYKKGAWCSLCTASVSGCFKAWDHAGGLCEVPRNPCRMSCQNHGRLNISTCHCHCPPGYTGRYCQVRCSLQCVHGRFREEECSCVCDIGYGGAQCATKVHFPFHTCDLRIDGDCFMVSSEADTYYRARMKCQVTVTPSFLGTP |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CLEC18C C-type lectin domain family 18 member C [ Homo sapiens (human) ] |
| Official Symbol | CLEC18C |
| Synonyms | CLEC18C; C-type lectin domain family 18 member C; MRCL; MRCL3; C-type lectin domain family 18 member C; mannose receptor-like 3; mannose receptor-like protein 3 |
| Gene ID | 283971 |
| mRNA Refseq | NM_173619 |
| Protein Refseq | NP_775890 |
| MIM | 616573 |
| UniProt ID | Q8NCF0 |
| ◆ Recombinant Proteins | ||
| CLEC18C-6393HF | Recombinant Full Length Human CLEC18C Protein, GST-tagged | +Inquiry |
| CLEC18C-5271H | Recombinant Human CLEC18C Protein, GST-tagged | +Inquiry |
| CLEC18C-32HFL | Recombinant Human Full Length CLEC18C Protein, GST&His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CLEC18C-7453HCL | Recombinant Human CLEC18C 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLEC18C Products
Required fields are marked with *
My Review for All CLEC18C Products
Required fields are marked with *
