Recombinant Human CLEC18C Protein, GST-tagged

• Cat.No.: CLEC18C-5271H
• Product Overview: Human MGC34761 full-length ORF ( AAH39068.1, 1 a.a. - 301 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: CLEC18C (C-Type Lectin Domain Family 18 Member C) is a Protein Coding gene. Diseases associated with CLEC18C include Atypical Lipomatous Tumor. Among its related pathways are Sertoli-Sertoli Cell Junction Dynamics and Actin Nucleation by ARP-WASP Complex. GO annotations related to this gene include carbohydrate binding. An important paralog of this gene is CLEC18A.
• Molecular Mass: 59.5 kDa
• AA Sequence: MAGALNRKESFLLLSLHNRLRSWVQPPAADRRRLDWSDSLAQLAQARAALCGIPTPSLASGLWRTLQVGWNMQLLPAGLASFVEVVSLWFAEGQRYSHAAGECARNATCTHYTQLVWATSSQLGCGRHLCSAGQAAIEAFVCAYSPRGNWEVNGKTIVPYKKGAWCSLCTASVSGCFKAWDHAGGLCEVPRNPCRMSCQNHGRLNISTCHCHCPPGYTGRYCQVRCSLQCVHGRFREEECSCVCDIGYGGAQCATKVHFPFHTCDLRIDGDCFMVSSEADTYYRARMKCQVTVTPSFLGTP
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CLEC18C C-type lectin domain family 18 member C [ Homo sapiens (human) ]
• Official Symbol: CLEC18C
• Synonyms: CLEC18C; C-type lectin domain family 18 member C; MRCL; MRCL3; C-type lectin domain family 18 member C; mannose receptor-like 3; mannose receptor-like protein 3
• Gene ID: 283971
• mRNA Refseq: NM_173619
• Protein Refseq: NP_775890
• MIM: 616573
• UniProt ID: Q8NCF0