Recombinant Human CLEC2B Protein, hIgG-His-tagged

Cat.No. : CLEC2B-001H
Product Overview : Recombinant human CLEC2B protein (26-149aa), fused to hIgG-His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
Availability December 11, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Insect Cells
Tag : Fc&His
Protein Length : 26-149 a.a.
Description : CLEC2B, also known as C-type lectin domain family 2 member B, is a type-2 transmembrane member of the C-type lectin-like receptor (CTLR) family. They play diverse functions, such as cell adhesion, cell-cell signaling, glycoprotein turnover, and roles in inflammation and immune response. This protein may function as a cell activation antigen. It has variant roles such as activating receptor that triggers TNF production, NK cell mediated lysis and interactions between activated and resting NK cells.
Form : Liquid
Molecular Mass : 41.7 kDa
N-terminal Sequence Analysis : Ala
Endotoxin : < 1.0 EU per 1 μg of protein (determined by LAL method)
Purity : > 90% by SDS - PAGE
Storage : Can be stored at +4 centigrade short term (1-2 weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 0.25 mg/mL (determined by Absorbance at 280nm)
Storage Buffer : In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol.
Warning : For research use only. This product is not intended or approved for human, diagnostics or veterin
AA Sequence : ADPKLTRDSQSLCPYDWIGFQNKCYYFSKEEGDWNSSKYNCSTQHADLTIIDNIEEMNFLRRYKCSSDHWIGLKMAKNRTGQWVDGATFTKSFGMRGSEGCAYLSDDGAATARCYTERKWICRKRIHLEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH
Gene Name CLEC2B C-type lectin domain family 2 member B [ Homo sapiens (human) ]
Official Symbol CLEC2B
Synonyms CLEC2B; C-type lectin domain family 2 member B; AICL; IFNRG1; CLECSF2; HP10085; C-type lectin domain family 2 member B; C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 2 (activation-induced); C-type lectin superfamily member 2; IFN-alpha-2b-inducing-related protein 1; IFN-alpha2b-inducing related protein 1; activation-induced C-type lectin
Gene ID 9976
mRNA Refseq NM_005127
Protein Refseq NP_005118
MIM 603242
UniProt ID Q92478

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CLEC2B Products

Required fields are marked with *

My Review for All CLEC2B Products

Required fields are marked with *

0
cart-icon
0
compare icon