Recombinant Human CLEC2B Protein, hIgG-His-tagged
Cat.No. : | CLEC2B-001H |
Product Overview : | Recombinant human CLEC2B protein (26-149aa), fused to hIgG-His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques. |
Availability | August 02, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Insect Cells |
Tag : | Fc&His |
Protein Length : | 26-149 a.a. |
Description : | CLEC2B, also known as C-type lectin domain family 2 member B, is a type-2 transmembrane member of the C-type lectin-like receptor (CTLR) family. They play diverse functions, such as cell adhesion, cell-cell signaling, glycoprotein turnover, and roles in inflammation and immune response. This protein may function as a cell activation antigen. It has variant roles such as activating receptor that triggers TNF production, NK cell mediated lysis and interactions between activated and resting NK cells. |
Form : | Liquid |
Molecular Mass : | 41.7 kDa |
N-terminal Sequence Analysis : | Ala |
Endotoxin : | < 1.0 EU per 1 μg of protein (determined by LAL method) |
Purity : | > 90% by SDS - PAGE |
Storage : | Can be stored at +4 centigrade short term (1-2 weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoid repeated freezing and thawing cycles. |
Concentration : | 0.25 mg/mL (determined by Absorbance at 280nm) |
Storage Buffer : | In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol. |
Warning : | For research use only. This product is not intended or approved for human, diagnostics or veterin |
AA Sequence : | ADPKLTRDSQSLCPYDWIGFQNKCYYFSKEEGDWNSSKYNCSTQHADLTIIDNIEEMNFLRRYKCSSDHWIGLKMAKNRTGQWVDGATFTKSFGMRGSEGCAYLSDDGAATARCYTERKWICRKRIHLEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH |
Gene Name | CLEC2B C-type lectin domain family 2 member B [ Homo sapiens (human) ] |
Official Symbol | CLEC2B |
Synonyms | CLEC2B; C-type lectin domain family 2 member B; AICL; IFNRG1; CLECSF2; HP10085; C-type lectin domain family 2 member B; C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 2 (activation-induced); C-type lectin superfamily member 2; IFN-alpha-2b-inducing-related protein 1; IFN-alpha2b-inducing related protein 1; activation-induced C-type lectin |
Gene ID | 9976 |
mRNA Refseq | NM_005127 |
Protein Refseq | NP_005118 |
MIM | 603242 |
UniProt ID | Q92478 |
◆ Recombinant Proteins | ||
CLEC2B-730R | Recombinant Rhesus Macaque CLEC2B Protein, His (Fc)-Avi-tagged | +Inquiry |
CLEC2B-454H | Recombinant Human CLEC2B Protein, Fc-tagged | +Inquiry |
CLEC2B-7120H | Recombinant Human CLEC2B, His-tagged | +Inquiry |
CLEC2B-905R | Recombinant Rhesus monkey CLEC2B Protein, His-tagged | +Inquiry |
CLEC2B-1462H | Recombinant Human CLEC2B Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLEC2B-7452HCL | Recombinant Human CLEC2B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLEC2B Products
Required fields are marked with *
My Review for All CLEC2B Products
Required fields are marked with *