Recombinant Human CLEC4C Protein (45-213 aa), His-tagged

• Cat.No.: CLEC4C-2074H
• Product Overview: Recombinant Human CLEC4C Protein (45-213 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial.

Specification

• Species: Human
• Source: Yeast
• Tag: His
• Protein Length: 45-213 aa
• Description: Involved in antigen-capturing. Target ligand into antigen processing and peptide-loading compartments for presentation to T-cells. May mediate potent inhibition of induction of IFN-alpha/beta expression in plasmacytoid dendritic cells. May act as a signaling receptor that activates protein-tyrosine kinases and mobilizes intracellular calcium. Does not seem to bind mannose.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 22.0 kDa
• AA Sequence: NFMYSKTVKRLSKLREYQQYHPSLTCVMEGKDIEDWSCCPTPWTSFQSSCYFISTGMQSWTKSQKNCSVMGADLVVINTREEQDFIIQNLKRNSSYFLGLSDPGGRRHWQWVDQTPYNENVTFWHSGEPNNLDERCAIINFRSSEEWGWNDIHCHVPQKSICKMKKIYI
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: CLEC4C C-type lectin domain family 4, member C [ Homo sapiens ]
• Official Symbol: CLEC4C
• Synonyms: DLEC; HECL; BDCA2; CD303; CLECSF7; CLECSF11; PRO34150
• Gene ID: 170482
• mRNA Refseq: NM_203503.1
• Protein Refseq: NP_987099.1
• MIM: 606677
• UniProt ID: Q8WTT0