Recombinant Human CLEC4C protein, His-Myc-tagged

• Cat.No.: CLEC4C-6744H
• Product Overview: Recombinant Human CLEC4C protein(Q8WTT0)(45-213aa), fused with N-terminal His and Myc tag, was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: His&Myc
• Protein Length: 45-213aa
• Tag: N-His-Myc
• Form: Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
• Bio-activity: Measured by its binding ability in a functional ELISA. Immobilized Human CLEC4C at 2 μg/mL can bind Anti-CLEC4C recombinant antibody,the EC50 is 7.658-12.99 ng/mL.
• Molecular Mass: 24.1 kDa
• Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
• Purity: Greater than 95% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: NFMYSKTVKRLSKLREYQQYHPSLTCVMEGKDIEDWSCCPTPWTSFQSSCYFISTGMQSWTKSQKNCSVMGADLVVINTREEQDFIIQNLKRNSSYFLGLSDPGGRRHWQWVDQTPYNENVTFWHSGEPNNLDERCAIINFRSSEEWGWNDIHCHVPQKSICKMKKIYI

Gene Information

• Gene Name: CLEC4C C-type lectin domain family 4, member C [ Homo sapiens ]
• Official Symbol: CLEC4C
• Synonyms: DLEC; HECL; BDCA2; CD303; CLECSF7; CLECSF11; PRO34150
• Gene ID: 170482
• mRNA Refseq: NM_203503.1
• Protein Refseq: NP_987099.1
• MIM: 606677
• UniProt ID: Q8WTT0