Recombinant Human CLEC4C protein, His-Myc-tagged

Cat.No. : CLEC4C-6744H
Product Overview : Recombinant Human CLEC4C protein(Q8WTT0)(45-213aa), fused with N-terminal His and Myc tag, was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His&Myc
Protein Length : 45-213aa
Tag : N-His-Myc
Form : Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Bio-activity : Measured by its binding ability in a functional ELISA. Immobilized Human CLEC4C at 2 μg/mL can bind Anti-CLEC4C recombinant antibody,the EC50 is 7.658-12.99 ng/mL.
Molecular Mass : 24.1 kDa
Endotoxin : Less than 1.0 EU/ug as determined by LAL method.
Purity : Greater than 95% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : NFMYSKTVKRLSKLREYQQYHPSLTCVMEGKDIEDWSCCPTPWTSFQSSCYFISTGMQSWTKSQKNCSVMGADLVVINTREEQDFIIQNLKRNSSYFLGLSDPGGRRHWQWVDQTPYNENVTFWHSGEPNNLDERCAIINFRSSEEWGWNDIHCHVPQKSICKMKKIYI
Gene Name CLEC4C C-type lectin domain family 4, member C [ Homo sapiens ]
Official Symbol CLEC4C
Synonyms DLEC; HECL; BDCA2; CD303; CLECSF7; CLECSF11; PRO34150
Gene ID 170482
mRNA Refseq NM_203503.1
Protein Refseq NP_987099.1
MIM 606677
UniProt ID Q8WTT0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CLEC4C Products

Required fields are marked with *

My Review for All CLEC4C Products

Required fields are marked with *

0
cart-icon