Recombinant Human CLEC4C Protein, His-tagged CLEC4C-1167H

Recombinant Human CLEC4C Protein, His-tagged

PRODUCTS

Home / Products / Recombinant Human CLEC4C Protein, His-tagged

Recombinant Human CLEC4C Protein, His-tagged

CLEC4C Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : CLEC4C-1167H
Product Overview : Recombinant Human CLEC4C Protein (45-213aa) was expressed in mammalian cells with N-terminal 6xHis tag
Source : HEK293
Species : Human
Tag : His
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 24 kDa
AA Sequence : NFMYSKTVKRLSKLREYQQYHPSLTCVMEGKDIEDWSCCPTPWTSFQSSCYFISTGMQSWTKSQKNCSVM
GADLVVINTREEQDFIIQNLKRNSSYFLGLSDPGGRRHWQWVDQTPYNENVTFWHSGEPNNLDERCAIIN
FRSSEEWGWNDIHCHVPQKSICKMKKIYI
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Figure :

Gene Name : CLEC4C C-type lectin domain family 4, member C [ Homo sapiens ]
Official Symbol : CLEC4C
Synonyms : DLEC; HECL; BDCA2; CD303; CLECSF7; CLECSF11; PRO34150
Gene ID : 170482
mRNA Refseq : NM_203503.1
Protein Refseq : NP_987099.1
MIM : 606677
UniProt ID : Q8WTT0

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy