Recombinant Human CLIP3 Protein, GST-tagged

Cat.No. : CLIP3-1489H
Product Overview : Human CLIPR-59 partial ORF ( NP_056341, 447 a.a. - 547 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 447-547 a.a.
Description : This gene encodes a member of the cytoplasmic linker protein 170 family. Members of this protein family contain a cytoskeleton-associated protein glycine-rich domain and mediate the interaction of microtubules with cellular organelles. The encoded protein plays a role in T cell apoptosis by facilitating the association of tubulin and the lipid raft ganglioside GD3. The encoded protein also functions as a scaffold protein mediating membrane localization of phosphorylated protein kinase B. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, Dec 2010]
Molecular Mass : 36.85 kDa
AA Sequence : GIELDQPTGKHDGSVFGVRYFTCPPRHGVFAPASRIQRIGGSTDSPGDSVGAKKVHQVTMTQPKRTFTTVRTPKDIASENSISRLLFCCWFPWMLRAEMQS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CLIP3 CAP-GLY domain containing linker protein 3 [ Homo sapiens ]
Official Symbol CLIP3
Synonyms CLIP3; CAP-GLY domain containing linker protein 3; CAP-Gly domain-containing linker protein 3; CLIP 170 related; CLIPR 59; restin like 1; RSNL1; restin-like 1; CLIP-170-related 59 kDa protein; cytoplasmic linker protein 170-related 59 kDa protein; CLIPR59; CLIPR-59; FLJ33413; DKFZp586N1922;
Gene ID 25999
mRNA Refseq NM_001199570
Protein Refseq NP_001186499
MIM 607382
UniProt ID Q96DZ5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CLIP3 Products

Required fields are marked with *

My Review for All CLIP3 Products

Required fields are marked with *

0
cart-icon