Recombinant Human CLIP3 Protein, GST-tagged
Cat.No. : | CLIP3-1489H |
Product Overview : | Human CLIPR-59 partial ORF ( NP_056341, 447 a.a. - 547 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 447-547 a.a. |
Description : | This gene encodes a member of the cytoplasmic linker protein 170 family. Members of this protein family contain a cytoskeleton-associated protein glycine-rich domain and mediate the interaction of microtubules with cellular organelles. The encoded protein plays a role in T cell apoptosis by facilitating the association of tubulin and the lipid raft ganglioside GD3. The encoded protein also functions as a scaffold protein mediating membrane localization of phosphorylated protein kinase B. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, Dec 2010] |
Molecular Mass : | 36.85 kDa |
AA Sequence : | GIELDQPTGKHDGSVFGVRYFTCPPRHGVFAPASRIQRIGGSTDSPGDSVGAKKVHQVTMTQPKRTFTTVRTPKDIASENSISRLLFCCWFPWMLRAEMQS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CLIP3 CAP-GLY domain containing linker protein 3 [ Homo sapiens ] |
Official Symbol | CLIP3 |
Synonyms | CLIP3; CAP-GLY domain containing linker protein 3; CAP-Gly domain-containing linker protein 3; CLIP 170 related; CLIPR 59; restin like 1; RSNL1; restin-like 1; CLIP-170-related 59 kDa protein; cytoplasmic linker protein 170-related 59 kDa protein; CLIPR59; CLIPR-59; FLJ33413; DKFZp586N1922; |
Gene ID | 25999 |
mRNA Refseq | NM_001199570 |
Protein Refseq | NP_001186499 |
MIM | 607382 |
UniProt ID | Q96DZ5 |
◆ Recombinant Proteins | ||
CLIP3-3584M | Recombinant Mouse CLIP3 Protein | +Inquiry |
CLIP3-736R | Recombinant Rhesus Macaque CLIP3 Protein, His (Fc)-Avi-tagged | +Inquiry |
CLIP3-3258H | Recombinant Human CLIP3 Protein, GST/His-tagged | +Inquiry |
CLIP3-911R | Recombinant Rhesus monkey CLIP3 Protein, His-tagged | +Inquiry |
CLIP3-1489H | Recombinant Human CLIP3 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLIP3-7443HCL | Recombinant Human CLIP3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLIP3 Products
Required fields are marked with *
My Review for All CLIP3 Products
Required fields are marked with *