Recombinant Human CLIP3 Protein, GST-tagged

• Cat.No.: CLIP3-1489H
• Product Overview: Human CLIPR-59 partial ORF ( NP_056341, 447 a.a. - 547 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 447-547 a.a.
• Description: This gene encodes a member of the cytoplasmic linker protein 170 family. Members of this protein family contain a cytoskeleton-associated protein glycine-rich domain and mediate the interaction of microtubules with cellular organelles. The encoded protein plays a role in T cell apoptosis by facilitating the association of tubulin and the lipid raft ganglioside GD3. The encoded protein also functions as a scaffold protein mediating membrane localization of phosphorylated protein kinase B. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, Dec 2010]
• Molecular Mass: 36.85 kDa
• AA Sequence: GIELDQPTGKHDGSVFGVRYFTCPPRHGVFAPASRIQRIGGSTDSPGDSVGAKKVHQVTMTQPKRTFTTVRTPKDIASENSISRLLFCCWFPWMLRAEMQS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CLIP3 CAP-GLY domain containing linker protein 3 [ Homo sapiens ]
• Official Symbol: CLIP3
• Synonyms: CLIP3; CAP-GLY domain containing linker protein 3; CAP-Gly domain-containing linker protein 3; CLIP 170 related; CLIPR 59; restin like 1; RSNL1; restin-like 1; CLIP-170-related 59 kDa protein; cytoplasmic linker protein 170-related 59 kDa protein; CLIPR59; CLIPR-59; FLJ33413; DKFZp586N1922
• Gene ID: 25999
• mRNA Refseq: NM_001199570
• Protein Refseq: NP_001186499
• MIM: 607382
• UniProt ID: Q96DZ5