Recombinant Human CLK1
Cat.No. : | CLK1-27274TH |
Product Overview : | Recombinant full length Human CLK1 with N terminal proprietary tag, predicted mwt: 79.31 kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a member of the CDC2-like (or LAMMER) family of dual specificity protein kinases. In the nucleus, the encoded protein phosphorylates serine/arginine-rich proteins involved in pre-mRNA processing, releasing them into the nucleoplasm. The choice of splice sites during pre-mRNA processing may be regulated by the concentration of transacting factors, including serine/arginine rich proteins. Therefore, the encoded protein may play an indirect role in governing splice site selection. Multiple transcript variants encoding different isoforms have been found for this gene. |
Protein length : | 484 amino acids |
Molecular Weight : | 79.310kDa inclusive of tags |
Source : | Wheat germ |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MRHSKRTYCPDWDDKDWDYGKWRSSSSHKRRKRSHSSAQE NKRCKYNHSKMCDSHYLESRSINEKDYHSRRYIDEYRNDY TQGCEPGHRQRDHESRYQNHSSKSSGRSGRSSYKSKHRIH HSTSHRRSHGKSHRRKRTRSVEDDEEGHLICQSGDVLSAR YEIVDTLGEGAFGKVVECIDHKAGGRHVAVKIVKNVDRYC EAARSEIQVLEHLNTTDPNSTFRCVQMLEWFEHHGHICIV FELLGLSTYDFIKENGFLPFRLDHIRKMAYQICKSVNFLH SNKLTHTDLKPENILFVQSDYTEAYNPKIKRDERTLINPD IKVVDFGSATYDDEHHSTLVSTRHYRAPEVILALGWSQPC DVWSIGCILIEYYLGFTVFPTHDSKEHLAMMERILGPLPK HMIQKTRKRKYFHHDRLDWDEHSSAGRYVSRRCKPLKEFM LSQDVEHERLFDLIQKMLEYDPAKRITLREALKHPFFDLL KKSI |
Sequence Similarities : | Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. Lammer subfamily.Contains 1 protein kinase domain. |
Gene Name : | CLK1 CDC-like kinase 1 [ Homo sapiens ] |
Official Symbol : | CLK1 |
Synonyms : | CLK1; CDC-like kinase 1; dual specificity protein kinase CLK1; |
Gene ID : | 1195 |
mRNA Refseq : | NM_001162407 |
Protein Refseq : | NP_001155879 |
MIM : | 601951 |
Uniprot ID : | P49759 |
Chromosome Location : | 2q33 |
Pathway : | Legionellosis, organism-specific biosystem; Legionellosis, conserved biosystem; mRNA processing, organism-specific biosystem; |
Function : | ATP binding; non-membrane spanning protein tyrosine kinase activity; nucleotide binding; protein serine/threonine kinase activity; protein serine/threonine/tyrosine kinase activity; |
Products Types
◆ Recombinant Protein | ||
CLK1-1490H | Active Recombinant Human CLK1 Protein, GST-His-tagged | +Inquiry |
CLK1-1491H | Recombinant Human CLK1 Protein, GST-tagged | +Inquiry |
CLK1-737R | Recombinant Rhesus Macaque CLK1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CLK1-1759M | Recombinant Mouse CLK1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CLK1-2688H | Recombinant Human CLK1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Lysates | ||
CLK1-7441HCL | Recombinant Human CLK1 293 Cell Lysate | +Inquiry |
◆ Assay kits | ||
Kit-1571 | CLK1 Kinase Binding Assay Kit | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (5)
Ask a questionCLK1 expression is tightly regulated at transcriptional and post-translational levels, ensuring its proper function in normal cellular processes.
Researchers often measure CLK1 activity through in vitro kinase assays or by monitoring its phosphorylation targets in cellular or tissue samples.
Yes, studies suggest that CLK1 inhibitors may have therapeutic potential for neurodegenerative disorders by modulating RNA splicing.
Some studies suggest that CLK1 mutations may be associated with certain diseases, but further research is needed to establish clear links.
Yes, several CLK1 inhibitors are in preclinical and clinical development as potential anticancer agents.
Customer Reviews (3)
Write a reviewThe manufacturer's commitment to customer satisfaction extends beyond technical support. They offer a comprehensive range of related products and resources to aid researchers in their trials.
From troubleshooting to optimizing experimental protocols, the manufacturer provides diligent support to ensure the success of the trial.
The CLK1 protein offers several advantageous features that make it an ideal choice for researchers conducting trials.
Ask a Question for All CLK1 Products
Required fields are marked with *
My Review for All CLK1 Products
Required fields are marked with *
Inquiry Basket