Recombinant Human CLLU1-AS1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: CLLU1-AS1-4288H
• Product Overview: CLLU1OS MS Standard C13 and N15-labeled recombinant protein (NP_001020403) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: CLLU1-AS1 (CLLU1 Antisense RNA 1) is an RNA Gene, and is affiliated with the lncRNA class.
• Molecular Mass: 10.8 kDa
• AA Sequence: MNKLGHNELKECLKTATDSLQTVQPSISQTCTSYGPALGAPLPGRNEVALLTSLPPNYEISEGKPRAISAYVRAGKGNVTRRRKKTHLGNDDGKKEAQEKMTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: CLLU1-AS1 CLLU1 antisense RNA 1 [ Homo sapiens (human) ]
• Official Symbol: CLLU1-AS1
• Synonyms: CLLU1-AS1; CLLU1 antisense RNA 1; CLLU1OS; chronic lymphocytic leukemia up-regulated 1 opposite strand; chronic lymphocytic leukemia up-regulated 1 overlapping strand; putative chronic lymphocytic leukemia up-regulated protein 1 opposite strand transcript protein
• Gene ID: 574016
• mRNA Refseq: NM_001025232
• Protein Refseq: NP_001020403
• MIM: 616989
• UniProt ID: Q5K130