Recombinant Human CLLU1 Protein, GST-tagged

Cat.No. : CLLU1-1503H
Product Overview : Human CLLU1 full-length ORF ( AAI46526.1, 1 a.a. - 121 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Expression of this gene has been shown to be upregulated in some individuals with chronic lymphocytic leukemia (CLL), and has been used for prognostic and diagnostic purposes. This gene was originally identified as a human-specific putative protein-coding gene due to the presence of a peptide (PAp00140670, HIIYSTFLSK) that could have supported translation at this locus. This peptide is not present in more recent builds of PeptideAtlas, and the presence of a protein product at this locus has not been independently verified. For this reason, this gene is being represented as non-coding. Sequence comparisons to other primates indicates that no other primate is predicted to contain an open reading frame. [provided by RefSeq, Feb 2017]
Molecular Mass : 40.26 kDa
AA Sequence : MFNKCSFHSSIYRPAADNSASSLCAIICFLNLVIECDLETNSEINKLIIYLFSQNNRIRFSKLLLKILFYISIFSYPELMCEQYVTFIKPGIHYGQVSKKHIIYSTFLSKNFKFQLLRVCW
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CLLU1 chronic lymphocytic leukemia up-regulated 1 [ Homo sapiens (human) ]
Official Symbol CLLU1
Synonyms CLLU1; chronic lymphocytic leukemia up-regulated 1; Chronic Lymphocytic Leukemia Up-Regulated 1
Gene ID 574028
MIM 616988
UniProt ID Q5K131

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CLLU1 Products

Required fields are marked with *

My Review for All CLLU1 Products

Required fields are marked with *

0
cart-icon