Recombinant Human CLPP Protein, GST-tagged

Cat.No. : CLPP-1512H
Product Overview : Human CLPP full-length ORF ( NP_006003.1, 1 a.a. - 277 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene belongs to the peptidase family S14 and hydrolyzes proteins into small peptides in the presence of ATP and magnesium. The protein is transported into mitochondrial matrix and is associated with the inner mitochondrial membrane. [provided by RefSeq, Jul 2008]
Molecular Mass : 56.6 kDa
AA Sequence : MWPGILVGGARVASCRYPALGPRLAAHFPAQRPPQRTLQNGLALQRCLHATATRALPLIPIVVEQTGRGERAYDIYSRLLRERIVCVMGPIDDSVASLVIAQLLFLQSESNKKPIHMYINSPGGVVTAGLAIYDTMQYILNPICTWCVGQAASMGSLLLAAGTPGMRHSLPNSRIMIHQPSGGARGQATDIAIQAEEIMKLKKQLYNIYAKHTKQSLQVIESAMERDRYMSPMEAQEFGILDKVLVHPPQDGEDEPTLVQKEPVEAAPAAEPVPAST
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CLPP ClpP caseinolytic peptidase, ATP-dependent, proteolytic subunit homolog (E. coli) [ Homo sapiens ]
Official Symbol CLPP
Synonyms CLPP; ClpP caseinolytic peptidase, ATP-dependent, proteolytic subunit homolog (E. coli); ClpP (caseinolytic protease, ATP dependent, proteolytic subunit, E. coli) homolog , ClpP caseinolytic protease, ATP dependent, proteolytic subunit homolog (E. coli); putative ATP-dependent Clp protease proteolytic subunit, mitochondrial; ATP dependent protease ClpAP (E. coli); proteolytic subunit; human; endopeptidase Clp; ATP-dependent protease ClpAP, proteolytic subunit, human; ClpP caseinolytic peptidase ATP-dependent, proteolytic subunit; ClpP caseinolytic protease, ATP-dependent, proteolytic subunit homolog;
Gene ID 8192
mRNA Refseq NM_006012
Protein Refseq NP_006003
MIM 601119
UniProt ID Q16740

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CLPP Products

Required fields are marked with *

My Review for All CLPP Products

Required fields are marked with *

0
cart-icon