Recombinant Human CLPP protein, His-tagged
| Cat.No. : | CLPP-3562H |
| Product Overview : | Recombinant Human CLPP protein(1-277 aa), fused to His tag, was expressed in E. coli. |
| Availability | August 18, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-277 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MWPGILVGGARVASCRYPALGPRLAAHFPAQRPPQRTLQNGLALQRCLHATATRALPLIPIVVEQTGRGERAYDIYSRLLRERIVCVMGPIDDSVASLVIAQLLFLQSESNKKPIHMYINSPGGVVTAGLAIYDTMQYILNPICTWCVGQAASMGSLLLAAGTPGMRHSLPNSRIMIHQPSGGARGQATDIAIQAEEIMKLKKQLYNIYAKHTKQSLQVIESAMERDRYMSPMEAQEFGILDKVLVHPPQDGEDEPTLVQKEPVEAAPAAEPVPAST |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | CLPP ClpP caseinolytic peptidase, ATP-dependent, proteolytic subunit homolog (E. coli) [ Homo sapiens ] |
| Official Symbol | CLPP |
| Synonyms | CLPP; ClpP caseinolytic peptidase, ATP-dependent, proteolytic subunit homolog (E. coli); ClpP (caseinolytic protease, ATP dependent, proteolytic subunit, E. coli) homolog , ClpP caseinolytic protease, ATP dependent, proteolytic subunit homolog (E. coli); putative ATP-dependent Clp protease proteolytic subunit, mitochondrial; ATP dependent protease ClpAP (E. coli); proteolytic subunit; human; endopeptidase Clp; ATP-dependent protease ClpAP, proteolytic subunit, human; ClpP caseinolytic peptidase ATP-dependent, proteolytic subunit; ClpP caseinolytic protease, ATP-dependent, proteolytic subunit homolog; |
| Gene ID | 8192 |
| mRNA Refseq | NM_006012 |
| Protein Refseq | NP_006003 |
| MIM | 601119 |
| UniProt ID | Q16740 |
| ◆ Recombinant Proteins | ||
| CLPP-3562H | Recombinant Human CLPP protein, His-tagged | +Inquiry |
| CLPP-11343H | Recombinant Human CLPP, GST-tagged | +Inquiry |
| CLPP-0097B | Recombinant Bacillus subtilis CLPP protein, His-tagged | +Inquiry |
| CLPP-3599M | Recombinant Mouse CLPP Protein | +Inquiry |
| CLPP-3538H | Recombinant Human CLPP, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CLPP-7434HCL | Recombinant Human CLPP 293 Cell Lysate | +Inquiry |
| CLPP-117HKCL | Human CLPP Knockdown Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLPP Products
Required fields are marked with *
My Review for All CLPP Products
Required fields are marked with *



