Recombinant Human CLPP protein, His-tagged
Cat.No. : | CLPP-3562H |
Product Overview : | Recombinant Human CLPP protein(1-277 aa), fused to His tag, was expressed in E. coli. |
Availability | April 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-277 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MWPGILVGGARVASCRYPALGPRLAAHFPAQRPPQRTLQNGLALQRCLHATATRALPLIPIVVEQTGRGERAYDIYSRLLRERIVCVMGPIDDSVASLVIAQLLFLQSESNKKPIHMYINSPGGVVTAGLAIYDTMQYILNPICTWCVGQAASMGSLLLAAGTPGMRHSLPNSRIMIHQPSGGARGQATDIAIQAEEIMKLKKQLYNIYAKHTKQSLQVIESAMERDRYMSPMEAQEFGILDKVLVHPPQDGEDEPTLVQKEPVEAAPAAEPVPAST |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | CLPP ClpP caseinolytic peptidase, ATP-dependent, proteolytic subunit homolog (E. coli) [ Homo sapiens ] |
Official Symbol | CLPP |
Synonyms | CLPP; ClpP caseinolytic peptidase, ATP-dependent, proteolytic subunit homolog (E. coli); ClpP (caseinolytic protease, ATP dependent, proteolytic subunit, E. coli) homolog , ClpP caseinolytic protease, ATP dependent, proteolytic subunit homolog (E. coli); putative ATP-dependent Clp protease proteolytic subunit, mitochondrial; ATP dependent protease ClpAP (E. coli); proteolytic subunit; human; endopeptidase Clp; ATP-dependent protease ClpAP, proteolytic subunit, human; ClpP caseinolytic peptidase ATP-dependent, proteolytic subunit; ClpP caseinolytic protease, ATP-dependent, proteolytic subunit homolog; |
Gene ID | 8192 |
mRNA Refseq | NM_006012 |
Protein Refseq | NP_006003 |
MIM | 601119 |
UniProt ID | Q16740 |
◆ Recombinant Proteins | ||
CLPP-1512H | Recombinant Human CLPP Protein, GST-tagged | +Inquiry |
CLPP-11343H | Recombinant Human CLPP, GST-tagged | +Inquiry |
CLPP-3562H | Recombinant Human CLPP protein, His-tagged | +Inquiry |
CLPP-1971C | Recombinant Clostridium Botulinum CLPP Protein (1-194 aa), His-SUMO-tagged | +Inquiry |
CLPP-937S | Recombinant Streptomyces coelicolor A3(2) CLPP protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLPP-7434HCL | Recombinant Human CLPP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CLPP Products
Required fields are marked with *
My Review for All CLPP Products
Required fields are marked with *
0
Inquiry Basket