Recombinant Human CLRN1 protein, His-tagged
Cat.No. : | CLRN1-2669H |
Product Overview : | Recombinant Human CLRN1 protein(156-232 aa), fused with N-terminal His tag, was expressed in E.coli. |
Availability | October 11, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 156-232 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | ASEVKIHHLSEKIANYKEGTYVYKTQSEKYTTSFWVIFFCFFVHFLNGLLIRLAGFQFPFAKSKDAETTNVAADLMY |
Purity : | 80%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | CLRN1 clarin 1 [ Homo sapiens ] |
Official Symbol | CLRN1 |
Synonyms | CLRN1; clarin 1; USH3, USH3A, Usher syndrome 3A; clarin-1; Usher syndrome type-3 protein; RP61; USH3; USH3A; |
Gene ID | 7401 |
mRNA Refseq | NM_001195794 |
Protein Refseq | NP_001182723 |
MIM | 606397 |
UniProt ID | P58418 |
◆ Recombinant Proteins | ||
CLRN1-743R | Recombinant Rhesus Macaque CLRN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CLRN1-2669H | Recombinant Human CLRN1 protein, His-tagged | +Inquiry |
RFL4097HF | Recombinant Full Length Human Clarin-1(Clrn1) Protein, His-Tagged | +Inquiry |
RFL25338RF | Recombinant Full Length Rat Clarin-1(Clrn1) Protein, His-Tagged | +Inquiry |
RFL8483MF | Recombinant Full Length Mouse Clarin-1(Clrn1) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLRN1-7432HCL | Recombinant Human CLRN1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLRN1 Products
Required fields are marked with *
My Review for All CLRN1 Products
Required fields are marked with *