Recombinant Human CLTB Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: CLTB-4563H
• Product Overview: CLTB MS Standard C13 and N15-labeled recombinant protein (NP_009028) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Clathrin is a large, soluble protein composed of heavy and light chains. It functions as the main structural component of the lattice-type cytoplasmic face of coated pits and vesicles which entrap specific macromolecules during receptor-mediated endocytosis. This gene encodes one of two clathrin light chain proteins which are believed to function as regulatory elements. Alternative splicing results in multiple transcript variants.
• Molecular Mass: 25 kDa
• AA Sequence: MADDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDEGFGAPAGSHAAPAQPGPTSGAGSEDMGTTVNGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAASKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRIADKAFYQQPDADIIGYVASEEAFVKESKEETPGTEWEKVAQLCDFNPKSSKQCKDVSRLRSVLMSLKQTPLSRTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: CLTB clathrin light chain B [ Homo sapiens (human) ]
• Official Symbol: CLTB
• Synonyms: CLTB; clathrin, light chain B; clathrin, light polypeptide (Lcb); clathrin light chain B; Lcb; clathrin, light chain (Lcb); LCB
• Gene ID: 1212
• mRNA Refseq: NM_007097
• Protein Refseq: NP_009028
• MIM: 118970
• UniProt ID: P09497