Recombinant Human CLTB Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | CLTB-4563H |
Product Overview : | CLTB MS Standard C13 and N15-labeled recombinant protein (NP_009028) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Clathrin is a large, soluble protein composed of heavy and light chains. It functions as the main structural component of the lattice-type cytoplasmic face of coated pits and vesicles which entrap specific macromolecules during receptor-mediated endocytosis. This gene encodes one of two clathrin light chain proteins which are believed to function as regulatory elements. Alternative splicing results in multiple transcript variants. |
Molecular Mass : | 25 kDa |
AA Sequence : | MADDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDEGFGAPAGSHAAPAQPGPTSGAGSEDMGTTVNGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAASKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRIADKAFYQQPDADIIGYVASEEAFVKESKEETPGTEWEKVAQLCDFNPKSSKQCKDVSRLRSVLMSLKQTPLSRTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | CLTB clathrin light chain B [ Homo sapiens (human) ] |
Official Symbol | CLTB |
Synonyms | CLTB; clathrin, light chain B; clathrin, light polypeptide (Lcb); clathrin light chain B; Lcb; clathrin, light chain (Lcb); LCB; |
Gene ID | 1212 |
mRNA Refseq | NM_007097 |
Protein Refseq | NP_009028 |
MIM | 118970 |
UniProt ID | P09497 |
◆ Recombinant Proteins | ||
CLTB-6968H | Recombinant Human Clathrin, Light Chain B, His-tagged | +Inquiry |
CLTB-801H | Recombinant Human CLTB Protein, His-tagged | +Inquiry |
CLTB-4563H | Recombinant Human CLTB Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CLTB-1128R | Recombinant Rat CLTB Protein, His (Fc)-Avi-tagged | +Inquiry |
CLTB-1470R | Recombinant Rat CLTB Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLTB-7427HCL | Recombinant Human CLTB 293 Cell Lysate | +Inquiry |
CLTB-7426HCL | Recombinant Human CLTB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLTB Products
Required fields are marked with *
My Review for All CLTB Products
Required fields are marked with *