Recombinant Full Length Human CLTB Protein, GST-tagged
| Cat.No. : | CLTB-1894HF | 
| Product Overview : | Human CLTB full-length ORF ( AAH06457, 1 a.a. - 211 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | In Vitro Cell Free System | 
| Tag : | GST | 
| Protein Length : | 211 amino acids | 
| Description : | Clathrin is a large, soluble protein composed of heavy and light chains. It functions as the main structural component of the lattice-type cytoplasmic face of coated pits and vesicles which entrap specific macromolecules during receptor-mediated endocytosis. This gene encodes one of two clathrin light chain proteins which are believed to function as regulatory elements. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2008] | 
| Molecular Mass : | 48.95 kDa | 
| AA Sequence : | MADDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDEGFGAPAGSHAAPAQPGPTSGAGSEDMGTTVNGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAASKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVAQLCDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR | 
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array | 
| Notes : | Best use within three months from the date of receipt of this protein. | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | CLTB clathrin, light chain B [ Homo sapiens ] | 
| Official Symbol | CLTB | 
| Synonyms | CLTB; clathrin, light chain B; clathrin, light polypeptide (Lcb); clathrin light chain B; Lcb; clathrin, light chain (Lcb); LCB | 
| Gene ID | 1212 | 
| mRNA Refseq | NM_001834 | 
| Protein Refseq | NP_001825 | 
| MIM | 118970 | 
| UniProt ID | P09497 | 
| ◆ Recombinant Proteins | ||
| Cltb-2200M | Recombinant Mouse Cltb Protein, Myc/DDK-tagged | +Inquiry | 
| CLTB-2320C | Recombinant Chicken CLTB | +Inquiry | 
| CLTB-1894HF | Recombinant Full Length Human CLTB Protein, GST-tagged | +Inquiry | 
| CLTB-1470R | Recombinant Rat CLTB Protein | +Inquiry | 
| CLTB-6968H | Recombinant Human Clathrin, Light Chain B, His-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| CLTB-7427HCL | Recombinant Human CLTB 293 Cell Lysate | +Inquiry | 
| CLTB-7426HCL | Recombinant Human CLTB 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLTB Products
Required fields are marked with *
My Review for All CLTB Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            