Recombinant Human CLU Protein, GST-tagged
Cat.No. : | CLU-1526H |
Product Overview : | Human CLU partial ORF ( NP_001822, 402 a.a. - 501 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a secreted chaperone that can under some stress conditions also be found in the cell cytosol. It has been suggested to be involved in several basic biological events such as cell death, tumor progression, and neurodegenerative disorders. Alternate splicing results in both coding and non-coding variants.[provided by RefSeq, May 2011] |
Molecular Mass : | 36.74 kDa |
AA Sequence : | WKMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKALQEYRKKHREE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CLU clusterin [ Homo sapiens ] |
Official Symbol | CLU |
Synonyms | CLU; clusterin; APOJ, CLI, clusterin (complement lysis inhibitor, SP 40,40, sulfated glycoprotein 2, testosterone repressed prostate message 2, apolipoprotein J); apolipoprotein J; complement lysis inhibitor; KUB1; SGP 2; SP 40; sulfated glycoprotein 2; testosterone repressed prostate message 2; TRPM 2; ku70-binding protein 1; aging-associated protein 4; complement cytolysis inhibitor; complement-associated protein SP-40,40; testosterone-repressed prostate message 2; CLI; AAG4; APOJ; SGP2; APO-J; SGP-2; SP-40; TRPM2; TRPM-2; NA1/NA2; MGC24903; |
Gene ID | 1191 |
mRNA Refseq | NM_001831 |
Protein Refseq | NP_001822 |
MIM | 185430 |
UniProt ID | P10909 |
◆ Recombinant Proteins | ||
CLU-5772C | Recombinant Cattle CLU protein, His & T7-tagged | +Inquiry |
CLU-1744H | Recombinant Human CLU Protein (Full length), C-His and Flag tagged | +Inquiry |
CLU-921R | Recombinant Rhesus monkey CLU Protein, His-tagged | +Inquiry |
CLU-5777R | Recombinant Rabbit CLU protein, His-tagged | +Inquiry |
Clu-3664R | Recombinant Rat Clu, His-tagged | +Inquiry |
◆ Native Proteins | ||
CLU-67H | Native Human Clusterin | +Inquiry |
CLU-19H | Native Human Clusterin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLU-2198HCL | Recombinant Human CLU cell lysate | +Inquiry |
CLU-2195MCL | Recombinant Mouse CLU cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLU Products
Required fields are marked with *
My Review for All CLU Products
Required fields are marked with *