Recombinant Human CLU Protein, GST-tagged
| Cat.No. : | CLU-1526H |
| Product Overview : | Human CLU partial ORF ( NP_001822, 402 a.a. - 501 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The protein encoded by this gene is a secreted chaperone that can under some stress conditions also be found in the cell cytosol. It has been suggested to be involved in several basic biological events such as cell death, tumor progression, and neurodegenerative disorders. Alternate splicing results in both coding and non-coding variants.[provided by RefSeq, May 2011] |
| Molecular Mass : | 36.74 kDa |
| AA Sequence : | WKMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKALQEYRKKHREE |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CLU clusterin [ Homo sapiens ] |
| Official Symbol | CLU |
| Synonyms | CLU; clusterin; APOJ, CLI, clusterin (complement lysis inhibitor, SP 40,40, sulfated glycoprotein 2, testosterone repressed prostate message 2, apolipoprotein J); apolipoprotein J; complement lysis inhibitor; KUB1; SGP 2; SP 40; sulfated glycoprotein 2; testosterone repressed prostate message 2; TRPM 2; ku70-binding protein 1; aging-associated protein 4; complement cytolysis inhibitor; complement-associated protein SP-40,40; testosterone-repressed prostate message 2; CLI; AAG4; APOJ; SGP2; APO-J; SGP-2; SP-40; TRPM2; TRPM-2; NA1/NA2; MGC24903; |
| Gene ID | 1191 |
| mRNA Refseq | NM_001831 |
| Protein Refseq | NP_001822 |
| MIM | 185430 |
| UniProt ID | P10909 |
| ◆ Recombinant Proteins | ||
| CLU-223H | Recombinant Human CLU, C13&N15-labeled | +Inquiry |
| CLU-1743H | Recombinant Human CLU Protein (Asp23-Glu449), C-His tagged | +Inquiry |
| CLU-266H | Recombinant Human clusterin Protein, His&Flag tagged | +Inquiry |
| CLU-11356H | Recombinant Human CLU, GST-tagged | +Inquiry |
| Clu-1867M | Recombinant Mouse Clusterin | +Inquiry |
| ◆ Native Proteins | ||
| CLU-19H | Native Human Clusterin Protein | +Inquiry |
| CLU-67H | Native Human Clusterin | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CLU-2195MCL | Recombinant Mouse CLU cell lysate | +Inquiry |
| CLU-2198HCL | Recombinant Human CLU cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLU Products
Required fields are marked with *
My Review for All CLU Products
Required fields are marked with *
