Recombinant Human CLU Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | CLU-4585H |
| Product Overview : | CLU MS Standard C13 and N15-labeled recombinant protein (NP_976084) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | The protein encoded by this gene is a secreted chaperone that can under some stress conditions also be found in the cell cytosol. It has been suggested to be involved in several basic biological events such as cell death, tumor progression, and neurodegenerative disorders. Alternate splicing results in both coding and non-coding variants. |
| Molecular Mass : | 52.5 kDa |
| AA Sequence : | MMKTLLLFVGLLLTWESGQVLGDQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTLLSNLEEAKKKKEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHMLDVMQDHFSRASSIIDELFQDRFFTREPQDTYHYLPFSLPHRRPHFFFPKSRIVRSLMPFSPYEPLNFHAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGDDDRTVCREIRHNSTGCLRMKDQCDKCREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKALQEYRKKHREESGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | CLU clusterin [ Homo sapiens (human) ] |
| Official Symbol | CLU |
| Synonyms | CLU; clusterin; APOJ, CLI, clusterin (complement lysis inhibitor, SP 40,40, sulfated glycoprotein 2, testosterone repressed prostate message 2, apolipoprotein J); apolipoprotein J; complement lysis inhibitor; KUB1; SGP 2; SP 40; sulfated glycoprotein 2; testosterone repressed prostate message 2; TRPM 2; ku70-binding protein 1; aging-associated protein 4; complement cytolysis inhibitor; complement-associated protein SP-40,40; testosterone-repressed prostate message 2; CLI; AAG4; APOJ; SGP2; APO-J; SGP-2; SP-40; TRPM2; TRPM-2; NA1/NA2; MGC24903; |
| Gene ID | 1191 |
| mRNA Refseq | NM_203339 |
| Protein Refseq | NP_976084 |
| MIM | 185430 |
| UniProt ID | P10909 |
| ◆ Recombinant Proteins | ||
| CLU-621H | Recombinant Human CLU Protein, His (Fc)-Avi-tagged | +Inquiry |
| CLU-5772C | Recombinant Cattle CLU protein, His & T7-tagged | +Inquiry |
| CLU-642G | Recombinant Golden hamster CLU protein, His&Myc-tagged | +Inquiry |
| Clu-108R | Recombinant Rattus Clusterin, His-tagged, T7-tagged | +Inquiry |
| CLU-1318C | Recombinant Canine Clusterin, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| CLU-67H | Native Human Clusterin | +Inquiry |
| CLU-19H | Native Human Clusterin Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CLU-2195MCL | Recombinant Mouse CLU cell lysate | +Inquiry |
| CLU-2198HCL | Recombinant Human CLU cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLU Products
Required fields are marked with *
My Review for All CLU Products
Required fields are marked with *
