Recombinant Human CLYBL protein, His-tagged
| Cat.No. : | CLYBL-3518H |
| Product Overview : | Recombinant Human CLYBL protein(1-340 aa), fused to His tag, was expressed in E. coli. |
| Availability | January 12, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-340 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MALRLLRRAARGAAAAALLRLKASLAADIPRLGYSSSSHHKYIPRRAVLYVPGNDEKKIKKIPSLNVDCAVLDCEDGVAANKKNEARLRIVKTLEDIDLGPTEKCVRVNSVSSGLAEEDLETLLQSRVLPSSLMLPKVESPEEIQWFADKFSFHLKGRKLEQPMNLIPFVETAMGLLNFKAVCEETLKVGPQVGLFLDAVVFGGEDFRASIGATSSKETLDILYARQKIVVIAKAFGLQAVDLVYIDFRDGAGLLRQSREGAAMGFTGKQVIHPNQIAVVQEQFSPSPEKIKWAEELIAAFKEHQQLGKGAFTFQGSMIDMPLLKQAQNTVTLATSIKEK |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | CLYBL citrate lyase beta like [ Homo sapiens ] |
| Official Symbol | CLYBL |
| Synonyms | CLYBL; citrate lyase beta like; citrate lyase subunit beta-like protein, mitochondrial; CLB; citrate lyase beta-like; bA134O15.1; |
| Gene ID | 171425 |
| mRNA Refseq | NM_206808 |
| Protein Refseq | NP_996531 |
| MIM | 609686 |
| UniProt ID | Q8N0X4 |
| ◆ Recombinant Proteins | ||
| CLYBL-1134R | Recombinant Rat CLYBL Protein, His (Fc)-Avi-tagged | +Inquiry |
| CLYBL-1897HF | Recombinant Full Length Human CLYBL Protein, GST-tagged | +Inquiry |
| CLYBL-3534Z | Recombinant Zebrafish CLYBL | +Inquiry |
| CLYBL-1777M | Recombinant Mouse CLYBL Protein, His (Fc)-Avi-tagged | +Inquiry |
| CLYBL-1476R | Recombinant Rat CLYBL Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CLYBL-7423HCL | Recombinant Human CLYBL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLYBL Products
Required fields are marked with *
My Review for All CLYBL Products
Required fields are marked with *
