Recombinant Human CLYBL protein, His-tagged
Cat.No. : | CLYBL-3518H |
Product Overview : | Recombinant Human CLYBL protein(1-340 aa), fused to His tag, was expressed in E. coli. |
Availability | September 14, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-340 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MALRLLRRAARGAAAAALLRLKASLAADIPRLGYSSSSHHKYIPRRAVLYVPGNDEKKIKKIPSLNVDCAVLDCEDGVAANKKNEARLRIVKTLEDIDLGPTEKCVRVNSVSSGLAEEDLETLLQSRVLPSSLMLPKVESPEEIQWFADKFSFHLKGRKLEQPMNLIPFVETAMGLLNFKAVCEETLKVGPQVGLFLDAVVFGGEDFRASIGATSSKETLDILYARQKIVVIAKAFGLQAVDLVYIDFRDGAGLLRQSREGAAMGFTGKQVIHPNQIAVVQEQFSPSPEKIKWAEELIAAFKEHQQLGKGAFTFQGSMIDMPLLKQAQNTVTLATSIKEK |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | CLYBL citrate lyase beta like [ Homo sapiens ] |
Official Symbol | CLYBL |
Synonyms | CLYBL; citrate lyase beta like; citrate lyase subunit beta-like protein, mitochondrial; CLB; citrate lyase beta-like; bA134O15.1; |
Gene ID | 171425 |
mRNA Refseq | NM_206808 |
Protein Refseq | NP_996531 |
MIM | 609686 |
UniProt ID | Q8N0X4 |
◆ Recombinant Proteins | ||
CLYBL-1134R | Recombinant Rat CLYBL Protein, His (Fc)-Avi-tagged | +Inquiry |
CLYBL-3534Z | Recombinant Zebrafish CLYBL | +Inquiry |
Clybl-2204M | Recombinant Mouse Clybl Protein, Myc/DDK-tagged | +Inquiry |
CLYBL-3518H | Recombinant Human CLYBL protein, His-tagged | +Inquiry |
CLYBL-1777M | Recombinant Mouse CLYBL Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLYBL-7423HCL | Recombinant Human CLYBL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLYBL Products
Required fields are marked with *
My Review for All CLYBL Products
Required fields are marked with *