Recombinant Full Length Human CLYBL Protein, GST-tagged
| Cat.No. : | CLYBL-1897HF |
| Product Overview : | Human CLYBL full-length ORF ( AAH34360.1, 1 a.a. - 340 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 340 amino acids |
| Description : | CLYBL (Citrate Lyase Beta Like) is a Protein Coding gene. Diseases associated with CLYBL include Dermatophytosis. GO annotations related to this gene include lyase activity. |
| Molecular Mass : | 63.7 kDa |
| AA Sequence : | MALRLLRRAARGAAAAALLRLKASLAADIPRLGYSSSSHHKYIPRRAVLYVPGNDEKKIKKIPSLNVDCAVLDCEDGVAANKKNEARLRIVKTLEDIDLGPTEKCVRVNSVSSGLAEEDLETLLQSRVLPSSLMLPKVESPEEIQWFADKFSFHLKGRKLEQPMNLIPFVETAMGLLNFKAVCEETLKVGPQVGLFLDAVVFGGEDFRASIGATSSKETLDILYARQKIVVIAKAFGLQAVDLVYIDFRDGAGLLRQSREGAAMGFTGKQVIHPNQIAVVQEQFSPSPEKIKWAEELIAAFKEHQQLGKGAFTFQGSMIDMPLLKQAQNTVTLATSIKEK |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CLYBL citrate lyase beta like [ Homo sapiens ] |
| Official Symbol | CLYBL |
| Synonyms | CLYBL; citrate lyase beta like; citrate lyase subunit beta-like protein, mitochondrial; CLB; citrate lyase beta-like; bA134O15.1 |
| Gene ID | 171425 |
| mRNA Refseq | NM_206808 |
| Protein Refseq | NP_996531 |
| MIM | 609686 |
| UniProt ID | Q8N0X4 |
| ◆ Recombinant Proteins | ||
| CLYBL-1897HF | Recombinant Full Length Human CLYBL Protein, GST-tagged | +Inquiry |
| CLYBL-3518H | Recombinant Human CLYBL protein, His-tagged | +Inquiry |
| CLYBL-1756H | Recombinant Human CLYBL Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| CLYBL-3617M | Recombinant Mouse CLYBL Protein | +Inquiry |
| CLYBL-3534Z | Recombinant Zebrafish CLYBL | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CLYBL-7423HCL | Recombinant Human CLYBL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLYBL Products
Required fields are marked with *
My Review for All CLYBL Products
Required fields are marked with *
