Recombinant Full Length Human CLYBL Protein, GST-tagged

Cat.No. : CLYBL-1897HF
Product Overview : Human CLYBL full-length ORF ( AAH34360.1, 1 a.a. - 340 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 340 amino acids
Description : CLYBL (Citrate Lyase Beta Like) is a Protein Coding gene. Diseases associated with CLYBL include Dermatophytosis. GO annotations related to this gene include lyase activity.
Molecular Mass : 63.7 kDa
AA Sequence : MALRLLRRAARGAAAAALLRLKASLAADIPRLGYSSSSHHKYIPRRAVLYVPGNDEKKIKKIPSLNVDCAVLDCEDGVAANKKNEARLRIVKTLEDIDLGPTEKCVRVNSVSSGLAEEDLETLLQSRVLPSSLMLPKVESPEEIQWFADKFSFHLKGRKLEQPMNLIPFVETAMGLLNFKAVCEETLKVGPQVGLFLDAVVFGGEDFRASIGATSSKETLDILYARQKIVVIAKAFGLQAVDLVYIDFRDGAGLLRQSREGAAMGFTGKQVIHPNQIAVVQEQFSPSPEKIKWAEELIAAFKEHQQLGKGAFTFQGSMIDMPLLKQAQNTVTLATSIKEK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CLYBL citrate lyase beta like [ Homo sapiens ]
Official Symbol CLYBL
Synonyms CLYBL; citrate lyase beta like; citrate lyase subunit beta-like protein, mitochondrial; CLB; citrate lyase beta-like; bA134O15.1
Gene ID 171425
mRNA Refseq NM_206808
Protein Refseq NP_996531
MIM 609686
UniProt ID Q8N0X4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CLYBL Products

Required fields are marked with *

My Review for All CLYBL Products

Required fields are marked with *

0
cart-icon