Recombinant Human CMAS protein, GST-tagged
| Cat.No. : | CMAS-301273H | 
| Product Overview : | Recombinant Human CMAS (1-263 aa) protein, fused to GST tag, was expressed in E. coli. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | E.coli | 
| Tag : | GST | 
| Protein Length : | Met1-Arg263 | 
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. | 
| AA Sequence : | MDSVEKGAATSVSNPRGRPSRGRPPKLQRNSRGGQGRGVEKPPHLAALILARGGSKGIPLKNIKHLAGVPLIGWVLRAALDSGAFQSVWVSTDHDEIENVAKQFGAQVHRRSSEVSKDSSTSLDAIIEFLNYHNEVDIVGNIQATSPCLHPTDLQKVAEMIREEGYDSVFSVVRRHQFRWSEIQKGVREVTEPLNLNPAKRPRRQDWDGELYENGSFYFAKRHLIEMGYLQGGKMAYYEMRAEHSVDIDVDIDWPIAEQRVLR | 
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. | 
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. | 
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. | 
| Gene Name | CMAS cytidine monophosphate N-acetylneuraminic acid synthetase [ Homo sapiens ] | 
| Official Symbol | CMAS | 
| Synonyms | CMAS; cytidine monophosphate N-acetylneuraminic acid synthetase; N-acylneuraminate cytidylyltransferase; CMP Neu5Ac synthetase; CMP-NeuNAc synthase; CMP-Neu5Ac synthetase; CMP-NeuNAc synthetase; CMP-N-acetylneuraminic acid synthase; CMP-N-acetylneuraminic acid synthetase; cytidine 5-monophosphate N-acetylneuraminic acid synthetase; | 
| Gene ID | 55907 | 
| mRNA Refseq | NM_018686 | 
| Protein Refseq | NP_061156 | 
| MIM | 603316 | 
| UniProt ID | Q8NFW8 | 
| ◆ Recombinant Proteins | ||
| Cmas-904M | Recombinant Mouse Cmas Protein, MYC/DDK-tagged | +Inquiry | 
| CMAS-751R | Recombinant Rhesus Macaque CMAS Protein, His (Fc)-Avi-tagged | +Inquiry | 
| CMAS-3557H | Recombinant Human CMAS Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry | 
| CMAS-1532H | Recombinant Human CMAS Protein, GST-tagged | +Inquiry | 
| CMAS-926R | Recombinant Rhesus monkey CMAS Protein, His-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| CMAS-7422HCL | Recombinant Human CMAS 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CMAS Products
Required fields are marked with *
My Review for All CMAS Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            