Recombinant Human CMAS Protein, GST-tagged
Cat.No. : | CMAS-1532H |
Product Overview : | Human CMAS full-length ORF ( AAH16609.1, 1 a.a. - 263 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes an enzyme that converts N-acetylneuraminic acid (NeuNAc) to cytidine 5'-monophosphate N-acetylneuraminic acid (CMP-NeuNAc). This process is important in the formation of sialylated glycoprotein and glycolipids. This modification plays a role in cell-cell communications and immune responses. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2016] |
Molecular Mass : | 56 kDa |
AA Sequence : | MDSVEKGAATSVSNPRGRPSRGRPPKLQRNSRGGQGRGVEKPPHLAALILARGGSKGIPLKNIKHLAGVPLIGWVLRAALDSGAFQSVWVSTDHDEIENVAKQFGAQVHRRSSEVSKDSSTSLDAIIEFLNYHNEVDIVGNIQATSPCLHPTDLQKVAEMIREEGYDSVFSVVRRHQFRWSEIQKGVREVTEPLNLNPAKRPRRQDWDGELYENGSFYFAKRHLIEMGYLQGGKMAYYEMRAEHSVDIDVDIDWPIAEQRVLR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CMAS cytidine monophosphate N-acetylneuraminic acid synthetase [ Homo sapiens ] |
Official Symbol | CMAS |
Synonyms | CMAS; cytidine monophosphate N-acetylneuraminic acid synthetase; N-acylneuraminate cytidylyltransferase; CMP Neu5Ac synthetase; CMP-NeuNAc synthase; CMP-Neu5Ac synthetase; CMP-NeuNAc synthetase; CMP-N-acetylneuraminic acid synthase; CMP-N-acetylneuraminic acid synthetase; cytidine 5-monophosphate N-acetylneuraminic acid synthetase; |
Gene ID | 55907 |
mRNA Refseq | NM_018686 |
Protein Refseq | NP_061156 |
MIM | 603316 |
UniProt ID | Q8NFW8 |
◆ Recombinant Proteins | ||
CMAS-3621M | Recombinant Mouse CMAS Protein | +Inquiry |
CMAS-301273H | Recombinant Human CMAS protein, GST-tagged | +Inquiry |
CMAS-1899HF | Recombinant Full Length Human CMAS Protein, GST-tagged | +Inquiry |
CMAS-3557H | Recombinant Human CMAS Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CMAS-751R | Recombinant Rhesus Macaque CMAS Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CMAS-7422HCL | Recombinant Human CMAS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CMAS Products
Required fields are marked with *
My Review for All CMAS Products
Required fields are marked with *