Recombinant Human CMAS Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | CMAS-3557H |
Product Overview : | CMAS MS Standard C13 and N15-labeled recombinant protein (NP_061156) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes an enzyme that converts N-acetylneuraminic acid (NeuNAc) to cytidine 5'-monophosphate N-acetylneuraminic acid (CMP-NeuNAc). This process is important in the formation of sialylated glycoprotein and glycolipids. This modification plays a role in cell-cell communications and immune responses. Alternative splicing results in multiple transcript variants. |
Molecular Mass : | 48.2 kDa |
AA Sequence : | MDSVEKGAATSVSNPRGRPSRGRPPKLQRNSRGGQGRGVEKPPHLAALILARGGSKGIPLKNIKHLAGVPLIGWVLRAALDSGAFQSVWVSTDHDEIENVAKQFGAQVHRRSSEVSKDSSTSLDAIIEFLNYHNEVDIVGNIQATSPCLHPTDLQKVAEMIREEGYDSVFSVVRRHQFRWSEIQKGVREVTEPLNLNPAKRPRRQDWDGELYENGSFYFAKRHLIEMGYLQGGKMAYYEMRAEHSVDIDVDIDWPIAEQRVLRYGYFGKEKLKEIKLLVCNIDGCLTNGHIYVSGDQKEIISYDVKDAIGISLLKKSGIEVRLISERACSKQTLSSLKLDCKMEVSVSDKLAVVDEWRKEMGLCWKEVAYLGNEVSDEECLKRVGLSGAPADACSTAQKAVGYICKCNGGRGAIREFAEHICLLMEKVNNSCQKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | CMAS cytidine monophosphate N-acetylneuraminic acid synthetase [ Homo sapiens (human) ] |
Official Symbol | CMAS |
Synonyms | CMAS; cytidine monophosphate N-acetylneuraminic acid synthetase; N-acylneuraminate cytidylyltransferase; CMP Neu5Ac synthetase; CMP-NeuNAc synthase; CMP-Neu5Ac synthetase; CMP-NeuNAc synthetase; CMP-N-acetylneuraminic acid synthase; CMP-N-acetylneuraminic acid synthetase; cytidine 5-monophosphate N-acetylneuraminic acid synthetase; |
Gene ID | 55907 |
mRNA Refseq | NM_018686 |
Protein Refseq | NP_061156 |
MIM | 603316 |
UniProt ID | Q8NFW8 |
◆ Recombinant Proteins | ||
CMAS-1899HF | Recombinant Full Length Human CMAS Protein, GST-tagged | +Inquiry |
CMAS-926R | Recombinant Rhesus monkey CMAS Protein, His-tagged | +Inquiry |
CMAS-751R | Recombinant Rhesus Macaque CMAS Protein, His (Fc)-Avi-tagged | +Inquiry |
CMAS-1532H | Recombinant Human CMAS Protein, GST-tagged | +Inquiry |
CMAS-1779M | Recombinant Mouse CMAS Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CMAS-7422HCL | Recombinant Human CMAS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CMAS Products
Required fields are marked with *
My Review for All CMAS Products
Required fields are marked with *