Recombinant Human CMC4 protein, GST-tagged

• Cat.No.: CMC4-4575H
• Product Overview: Recombinant Human CMC4 protein(6-68 aa), fused with N-terminal GST tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 6-68 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH).
• AASequence: PCQKQACEIQKCLQANSYMESKCQAVIQELRKCCAQYPKGRSVVCSGFEKEEEENLTRKSASK
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: CMC4 C-x(9)-C motif containing 4 homolog (S. cerevisiae) [ Homo sapiens (human) ]
• Official Symbol: CMC4
• Synonyms: CMC4; p8; C6.1B; MTCP1; MTCP1B; MTCP1NB; p8MTCP1; C-x(9)-C motif containing 4 homolog (S. cerevisiae); cx9C motif-containing protein 4; MTCP-1 type A; protein p8 MTCP-1; mature T-cell proliferation-1 type A; mature T-cell proliferation 1, isoform p8; mature T-cell proliferation 1 neighbor protein
• Gene ID: 100272147
• mRNA Refseq: NM_001018024
• Protein Refseq: NP_001018024
• UniProt ID: P56277