Recombinant Human CMKLR1 protein, His-tagged
Cat.No. : | CMKLR1-7854H |
Product Overview : | Recombinant Human CMKLR1 protein(300-373 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 300-373 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
AASequence : | LATALAIANSCMNPILYVFMGQDFKKFKVALFSRLVNALSEDTGHSSYPSHRSFTKMSSMNERTSMNERETGML |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | CMKLR1 chemokine-like receptor 1 [ Homo sapiens ] |
Official Symbol | CMKLR1 |
Synonyms | CMKLR1; chemokine-like receptor 1; chemokine receptor-like 1; G-protein coupled receptor DEZ; G-protein coupled receptor ChemR23; orphan G-protein coupled receptor, Dez; DEZ; ChemR23; CHEMERINR; MGC126105; MGC126106; |
Gene ID | 1240 |
mRNA Refseq | NM_001142343 |
Protein Refseq | NP_001135815 |
MIM | 602351 |
UniProt ID | Q99788 |
◆ Recombinant Proteins | ||
CMKLR1-4633H | Recombinant Human CMKLR1 protein, His-GST&Myc-tagged | +Inquiry |
CMKLR1-1904HF | Recombinant Full Length Human CMKLR1 Protein | +Inquiry |
CMKLR1-3624M | Recombinant Mouse CMKLR1 Protein | +Inquiry |
CMKLR1-0234H | Recombinant Human CMKLR1 Full Length Transmembrane protein, Flag-tagged(Nanodisc) | +Inquiry |
RFL13564RF | Recombinant Full Length Rat Chemokine-Like Receptor 1(Cmklr1) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CMKLR1-189HCL | Recombinant Human CMKLR1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CMKLR1 Products
Required fields are marked with *
My Review for All CMKLR1 Products
Required fields are marked with *