Recombinant Human CMSS1 Protein, GST-Tagged
| Cat.No. : | CMSS1-0022H |
| Product Overview : | Human C3orf26 full-length ORF (NP_115735.1, 1 a.a. - 279 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | CMSS1 (Cms1 Ribosomal Small Subunit Homolog (Yeast)) is a Protein Coding gene. Diseases associated with CMSS1 include Refractive Error. GO annotations related to this gene include nucleic acid binding and poly(A) RNA binding. |
| Molecular Mass : | 58.2 kDa |
| AA Sequence : | MADDLGDEWWENQPTGAGSSPEASDGEGEGDTEVMQQETVPVPVPSEKTKQPKECFLIQPKERKENTTKTRKRRKKKITDVLAKSEPKPGLPEDLQKLMKDYYSSRRLVIELEELNLPDSCFLKANDLTHSLSSYLKGICPKWVKLRKNHSEKKSVLMLIICSSAVRALELIRSMTAFRGDGKVIKLFAKHIKVQAQVKLLEKRVVHLGVGTPGRIKELVKQGGLNLSPLKFLVFDWNWRDQKLRRMMDIPEIRKEVFELLEMGVLSLCKSESLKLGLF |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CMSS1 cms1 ribosomal small subunit homolog (yeast) [ Homo sapiens (human) ] |
| Official Symbol | CMSS1 |
| Synonyms | CMSS1; cms1 ribosomal small subunit homolog (yeast); |
| Gene ID | 84319 |
| mRNA Refseq | NM_032359 |
| Protein Refseq | NP_115735 |
| UniProt ID | Q9BQ75 |
| ◆ Recombinant Proteins | ||
| Cmss1-2210M | Recombinant Mouse Cmss1 Protein, Myc/DDK-tagged | +Inquiry |
| CMSS1-1372H | Recombinant Human CMSS1 | +Inquiry |
| CMSS1-3252HF | Recombinant Full Length Human CMSS1 Protein, GST-tagged | +Inquiry |
| CMSS1-755R | Recombinant Rhesus Macaque CMSS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CMSS1-3269H | Recombinant Human CMSS1 Protein, MYC/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CMSS1 Products
Required fields are marked with *
My Review for All CMSS1 Products
Required fields are marked with *



