Recombinant Full Length Human CMSS1 Protein, GST-tagged
Cat.No. : | CMSS1-3252HF |
Product Overview : | Human C3orf26 full-length ORF (NP_115735.1, 1 a.a. - 279 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 279 amino acids |
Description : | CMSS1 (Cms1 Ribosomal Small Subunit Homolog (Yeast)) is a Protein Coding gene. Diseases associated with CMSS1 include Refractive Error. GO annotations related to this gene include nucleic acid binding and poly(A) RNA binding. |
Molecular Mass : | 58.2 kDa |
AA Sequence : | MADDLGDEWWENQPTGAGSSPEASDGEGEGDTEVMQQETVPVPVPSEKTKQPKECFLIQPKERKENTTKTRKRRKKKITDVLAKSEPKPGLPEDLQKLMKDYYSSRRLVIELEELNLPDSCFLKANDLTHSLSSYLKGICPKWVKLRKNHSEKKSVLMLIICSSAVRALELIRSMTAFRGDGKVIKLFAKHIKVQAQVKLLEKRVVHLGVGTPGRIKELVKQGGLNLSPLKFLVFDWNWRDQKLRRMMDIPEIRKEVFELLEMGVLSLCKSESLKLGLF |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CMSS1 cms1 ribosomal small subunit homolog (yeast) [ Homo sapiens (human) ] |
Official Symbol | CMSS1 |
Synonyms | CMSS1; cms1 ribosomal small subunit homolog (yeast); |
Gene ID | 84319 |
mRNA Refseq | NM_032359 |
Protein Refseq | NP_115735 |
UniProt ID | Q9BQ75 |
◆ Recombinant Proteins | ||
CMSS1-1139R | Recombinant Rat CMSS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CMSS1-1481R | Recombinant Rat CMSS1 Protein | +Inquiry |
CMSS1-2697H | Recombinant Human CMSS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CMSS1-4892H | Recombinant Human CMSS1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CMSS1-0022H | Recombinant Human CMSS1 Protein, GST-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CMSS1 Products
Required fields are marked with *
My Review for All CMSS1 Products
Required fields are marked with *