Recombinant Human CMTM1 Protein, GST-tagged
Cat.No. : | CMTM1-1543H |
Product Overview : | Human CMTM1 full-length ORF ( NP_851787.1, 1 a.a. - 114 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene belongs to the chemokine-like factor gene superfamily, a novel family that is similar to the chemokine and the transmembrane 4 superfamilies of signaling molecules. The protein encoded by this gene may play an important role in testicular development. Alternatively spliced transcript variants encoding different isoforms have been identified. Naturally occurring read-through transcription occurs between this locus and the neighboring locus CKLF (chemokine-like factor).[provided by RefSeq, Feb 2011] |
Molecular Mass : | 39 kDa |
AA Sequence : | MDPEHAKPESSEAPSGNLKQPETAAALSLILGALACFIITQANESFITITSLEICIVVFFILIYVLTLHHLLTYLHWPLLDLTNSIITAVFLSVVAILAMQEKKRRHLLYVGGR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CMTM1 CKLF-like MARVEL transmembrane domain containing 1 [ Homo sapiens ] |
Official Symbol | CMTM1 |
Synonyms | CMTM1; CKLF-like MARVEL transmembrane domain containing 1; chemokine like factor super family 1 , chemokine like factor superfamily 1 , CKLFSF1; CKLF-like MARVEL transmembrane domain-containing protein 1; CKLFH; CKLFH1a; chemokine-like factor superfamily 1; chemokine-like factor super family 1; chemokine-like factor-like protein CKLFH1; chemokine-like factor superfamily member 1; CKLFH1; CKLFSF1; MGC71870; |
Gene ID | 113540 |
mRNA Refseq | NM_052999 |
Protein Refseq | NP_443725 |
MIM | 607884 |
UniProt ID | Q8IZ96 |
◆ Recombinant Proteins | ||
RFL14607HF | Recombinant Full Length Human Cklf-Like Marvel Transmembrane Domain-Containing Protein 1(Cmtm1) Protein, His-Tagged | +Inquiry |
CMTM1-1543H | Recombinant Human CMTM1 Protein, GST-tagged | +Inquiry |
CMTM1-1781H | Recombinant Human CMTM1 protein, His & T7-tagged | +Inquiry |
CMTM1-1906HF | Recombinant Full Length Human CMTM1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CMTM1-371HCL | Recombinant Human CMTM1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CMTM1 Products
Required fields are marked with *
My Review for All CMTM1 Products
Required fields are marked with *