Recombinant Human CMTM5 Protein, GST-tagged
| Cat.No. : | CMTM5-1395H | 
| Product Overview : | Human CKLFSF5 full-length ORF ( AAH13109, 1 a.a. - 156 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | Wheat Germ | 
| Tag : | GST | 
| Description : | This gene encodes a member of the chemokine-like factor superfamily. This family of genes encodes multi-pass membrane proteins that are similar to both the chemokine and the transmembrane 4 superfamilies of signaling molecules. The encoded protein may exhibit tumor suppressor activity. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2014] | 
| Molecular Mass : | 42.9 kDa | 
| AA Sequence : | MLSARDRRDRHPEEGVVAELQGFAVDKAFLTSHKGILLETELALTLIIFICFTASISAYMAAALLEFFITLAFLFLYATQYYQRFDRINWPCLDFLRCVSAIIIFLVVSFAAVTSRDGAAIAAFVFGIILVSIFAYDAFKIYRTEMAPGASQGDQQ | 
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array | 
| Notes : | Best use within three months from the date of receipt of this protein. | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | CMTM5 CKLF-like MARVEL transmembrane domain containing 5 [ Homo sapiens ] | 
| Official Symbol | CMTM5 | 
| Synonyms | CMTM5; CKLF-like MARVEL transmembrane domain containing 5; chemokine like factor super family 5 , chemokine like factor superfamily 5 , CKLFSF5; CKLF-like MARVEL transmembrane domain-containing protein 5; FLJ37521; chemokine-like factor super family 5; chemokine-like factor superfamily member 5; CKLFSF5; | 
| Gene ID | 116173 | 
| mRNA Refseq | NM_001037288 | 
| Protein Refseq | NP_001032365 | 
| MIM | 607888 | 
| UniProt ID | Q96DZ9 | 
| ◆ Recombinant Proteins | ||
| CMTM5-1863HF | Recombinant Full Length Human CMTM5 Protein, GST-tagged | +Inquiry | 
| CMTM5-1792M | Recombinant Mouse CMTM5 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| CMTM5-3636M | Recombinant Mouse CMTM5 Protein | +Inquiry | 
| RFL9236MF | Recombinant Full Length Mouse Cklf-Like Marvel Transmembrane Domain-Containing Protein 5(Cmtm5) Protein, His-Tagged | +Inquiry | 
| CMTM5-1395H | Recombinant Human CMTM5 Protein, GST-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| CMTM5-7417HCL | Recombinant Human CMTM5 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CMTM5 Products
Required fields are marked with *
My Review for All CMTM5 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            