Recombinant Human CMTM5 Protein, GST-tagged
Cat.No. : | CMTM5-1395H |
Product Overview : | Human CKLFSF5 full-length ORF ( AAH13109, 1 a.a. - 156 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the chemokine-like factor superfamily. This family of genes encodes multi-pass membrane proteins that are similar to both the chemokine and the transmembrane 4 superfamilies of signaling molecules. The encoded protein may exhibit tumor suppressor activity. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2014] |
Molecular Mass : | 42.9 kDa |
AA Sequence : | MLSARDRRDRHPEEGVVAELQGFAVDKAFLTSHKGILLETELALTLIIFICFTASISAYMAAALLEFFITLAFLFLYATQYYQRFDRINWPCLDFLRCVSAIIIFLVVSFAAVTSRDGAAIAAFVFGIILVSIFAYDAFKIYRTEMAPGASQGDQQ |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CMTM5 CKLF-like MARVEL transmembrane domain containing 5 [ Homo sapiens ] |
Official Symbol | CMTM5 |
Synonyms | CMTM5; CKLF-like MARVEL transmembrane domain containing 5; chemokine like factor super family 5 , chemokine like factor superfamily 5 , CKLFSF5; CKLF-like MARVEL transmembrane domain-containing protein 5; FLJ37521; chemokine-like factor super family 5; chemokine-like factor superfamily member 5; CKLFSF5; |
Gene ID | 116173 |
mRNA Refseq | NM_001037288 |
Protein Refseq | NP_001032365 |
MIM | 607888 |
UniProt ID | Q96DZ9 |
◆ Recombinant Proteins | ||
RFL24636HF | Recombinant Full Length Human Cklf-Like Marvel Transmembrane Domain-Containing Protein 5(Cmtm5) Protein, His-Tagged | +Inquiry |
CMTM5-1863HF | Recombinant Full Length Human CMTM5 Protein, GST-tagged | +Inquiry |
CMTM5-1395H | Recombinant Human CMTM5 Protein, GST-tagged | +Inquiry |
CMTM5-3636M | Recombinant Mouse CMTM5 Protein | +Inquiry |
CMTM5-1792M | Recombinant Mouse CMTM5 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CMTM5-7417HCL | Recombinant Human CMTM5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CMTM5 Products
Required fields are marked with *
My Review for All CMTM5 Products
Required fields are marked with *
0
Inquiry Basket