Recombinant Human CNDP1 Protein
Cat.No. : | CNDP1-788H |
Product Overview : | Recombinant human CNDP1 protein without tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Protein Length : | 507 |
Description : | This gene encodes a member of the M20 metalloprotease family. The encoded protein is specifically expressed in the brain, is a homodimeric dipeptidase which was identified as human carnosinase. This gene contains trinucleotide (CTG) repeat length polymorphism in the coding region. |
Form : | Lyophilized |
Molecular Mass : | 54.7 kDa |
AA Sequence : | MDPKLGRMAASLLAVLLLLLERGMFSSPSPPPALLEKVFQYIDLHQDEFVQTLKEWVAIESDSVQPVPRFRQELFRMMAVAADTLQRLGARVASVDMGPQQLPDGQSLPIPPIILAELGSDPTKGTVCFYGHLDVQPADRGDGWLTDPYVLTEVDGKLYGRGATDNKGPVLAWINAVSAFRALEQDLPVNIKFIIEGMEEAGSVALEELVEKEKDRFFSGVDYIVISDNLWISQRKPAITYGTRGNSYFMVEVKCRDQDFHSGTFGGILHEPMADLVALLGSLVDSSGHILVPGIYDEVVPLTEEEINTYKAIHLDLEEYRNSSRVEKFLFDTKEEILMHLWRYPSLSIHGIEGAFDEPGTKTVIPGRVIGKFSIRLVPHMNVSAVEKQVTRHLEDVFSKRNSSNKMVVSMTLGLHPWIANIDDTQYLAAKRAIRTVFGTEPDMIRDGSTIPIAKMFQEIVHKSVVLIPLGAVDDGEHSQNEKINRWNYIEGTKLFAAFFLEMAQLH |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Concentration : | 1 mg/mL |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | CNDP1 carnosine dipeptidase 1 (metallopeptidase M20 family) [ Homo sapiens (human) ] |
Official Symbol | CNDP1 |
Synonyms | CNDP1; carnosine dipeptidase 1 (metallopeptidase M20 family); beta-Ala-His dipeptidase; carnosinase 1; CN1; CPGL2; glutamate carboxypeptidase like protein 2; HsT2308; MGC10825; serum carnosinase; CNDP dipeptidase 1; glutamate carboxypeptidase-like protein 2; MGC102737; MGC142072; |
Gene ID | 84735 |
mRNA Refseq | NM_032649 |
Protein Refseq | NP_116038 |
MIM | 609064 |
UniProt ID | Q96KN2 |
◆ Recombinant Proteins | ||
CNDP1-939M | Active Recombinant Mouse CNDP1 Protein, His-tagged | +Inquiry |
CNDP1-788H | Recombinant Human CNDP1 Protein | +Inquiry |
CNDP1-272H | Active Recombinant Human CNDP1, His-tagged | +Inquiry |
CNDP1-335H | Recombinant Human CNDP1 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
CNDP1-1552H | Recombinant Human CNDP1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CNDP1-1580MCL | Recombinant Mouse CNDP1 cell lysate | +Inquiry |
CNDP1-3037HCL | Recombinant Human CNDP1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CNDP1 Products
Required fields are marked with *
My Review for All CNDP1 Products
Required fields are marked with *
0
Inquiry Basket