Recombinant Human CNGA3 protein, GST-tagged
| Cat.No. : | CNGA3-157H |
| Product Overview : | Recombinant Human CNGA3 protein(NP_001073347)(590-694 aa), fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 590-694 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | EYPEAKKALEEKGRQILMKDNLIDEELARAGADPKDLEEKVEQLGSSLDTLQTRFARLLAEYNATQMKMKQRLSQLESQVKGGGDKPLADGEVPGDATKTEDKQQ |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Aliquot and store at -20°C to -80°C for up to 6 months. Avoid repeat freeze-thaw cycles. |
| Concentration : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | CNGA3 cyclic nucleotide gated channel alpha 3 [ Homo sapiens ] |
| Official Symbol | CNGA3 |
| Synonyms | CNGA3; cyclic nucleotide gated channel alpha 3; ACHM2, CNCG3; cyclic nucleotide-gated cation channel alpha-3; CCNC1; CCNCa; CNG3; CNG-3; CNG channel alpha-3; cyclic nucleotide-gated channel alpha-3; cone photoreceptor cGMP-gated channel alpha subunit; cone photoreceptor cGMP-gated channel subunit alpha; ACHM2; CNCG3; CCNCalpha; |
| Gene ID | 1261 |
| mRNA Refseq | NM_001079878 |
| Protein Refseq | NP_001073347 |
| MIM | 600053 |
| UniProt ID | Q16281 |
| ◆ Recombinant Proteins | ||
| CNGA3-157H | Recombinant Human CNGA3 protein, GST-tagged | +Inquiry |
| CNGA3-6774C | Recombinant Chicken CNGA3 | +Inquiry |
| RFL9350HF | Recombinant Full Length Human Cyclic Nucleotide-Gated Cation Channel Alpha-3(Cnga3) Protein, His-Tagged | +Inquiry |
| CNGA3-1799M | Recombinant Mouse CNGA3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CNGA3-3646M | Recombinant Mouse CNGA3 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CNGA3-7410HCL | Recombinant Human CNGA3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CNGA3 Products
Required fields are marked with *
My Review for All CNGA3 Products
Required fields are marked with *
