Recombinant Human CNGA3 protein, GST-tagged

Cat.No. : CNGA3-157H
Product Overview : Recombinant Human CNGA3 protein(NP_001073347)(590-694 aa), fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 590-694 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : EYPEAKKALEEKGRQILMKDNLIDEELARAGADPKDLEEKVEQLGSSLDTLQTRFARLLAEYNATQMKMKQRLSQLESQVKGGGDKPLADGEVPGDATKTEDKQQ
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Aliquot and store at -20°C to -80°C for up to 6 months. Avoid repeat freeze-thaw cycles.
Concentration : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name CNGA3 cyclic nucleotide gated channel alpha 3 [ Homo sapiens ]
Official Symbol CNGA3
Synonyms CNGA3; cyclic nucleotide gated channel alpha 3; ACHM2, CNCG3; cyclic nucleotide-gated cation channel alpha-3; CCNC1; CCNCa; CNG3; CNG-3; CNG channel alpha-3; cyclic nucleotide-gated channel alpha-3; cone photoreceptor cGMP-gated channel alpha subunit; cone photoreceptor cGMP-gated channel subunit alpha; ACHM2; CNCG3; CCNCalpha;
Gene ID 1261
mRNA Refseq NM_001079878
Protein Refseq NP_001073347
MIM 600053
UniProt ID Q16281

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CNGA3 Products

Required fields are marked with *

My Review for All CNGA3 Products

Required fields are marked with *

0
cart-icon