Recombinant Human CNIH2 Protein, GST-tagged

Cat.No. : CNIH2-1560H
Product Overview : Human CNIH2 full-length ORF ( NP_872359.1, 1 a.a. - 160 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is an auxiliary subunit of the ionotropic glutamate receptor of the AMPA subtype. AMPA receptors mediate fast synaptic neurotransmission in the central nervous system. This protein has been reported to interact with the Type I AMPA receptor regulatory protein isoform gamma-8 to control assembly of hippocampal AMPA receptor complexes, thereby modulating receptor gating and pharmacology. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2012]
Molecular Mass : 45.3 kDa
AA Sequence : MAFTFAAFCYMLTLVLCASLIFFVIWHIIAFDELRTDFKNPIDQGNPARARERLKNIERICCLLRKLVVPEYSIHGLFCLMFLCAAEWVTLGLNIPLLFYHLWRYFHRPADGSEVMYDAVSIMNADILNYCQKESWCKLAFYLLSFFYYLYSMVYTLVSF
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CNIH2 cornichon homolog 2 (Drosophila) [ Homo sapiens ]
Official Symbol CNIH2
Synonyms Cnil; CNIH-2
Gene ID 254263
mRNA Refseq NM_182553.2
Protein Refseq NP_872359.1
MIM 611288
UniProt ID Q6PI25

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CNIH2 Products

Required fields are marked with *

My Review for All CNIH2 Products

Required fields are marked with *

0
cart-icon
0
compare icon