Recombinant Human CNIH3 Protein, GST-tagged
Cat.No. : | CNIH3-1561H |
Product Overview : | Human CNIH3 full-length ORF ( AAH22780, 1 a.a. - 160 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | CNIH3 (Cornichon Family AMPA Receptor Auxiliary Protein 3) is a Protein Coding gene. Among its related pathways are Transport to the Golgi and subsequent modification and Vesicle-mediated transport. GO annotations related to this gene include channel regulator activity. An important paralog of this gene is CNIH2. |
Molecular Mass : | 43.34 kDa |
AA Sequence : | MAFTFAAFCYMLSLVLCAALIFFAIWHIIAFDELRTDFKSPIDQCNPVHARERLRNIERICFLLRKLVLPEYSIHSLFCIMFLCAQEWLTLGLNVPLLFYHFWRYFHCPADSSELAYDPPVVMNADTLSYCQKEAWCKLAFYLLSFFYYLYCMIYTLVSS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CNIH3 cornichon homolog 3 (Drosophila) [ Homo sapiens ] |
Official Symbol | CNIH3 |
Synonyms | CNIH3; cornichon homolog 3 (Drosophila); protein cornichon homolog 3; CNIH 3; FLJ38993; CNIH-3; |
Gene ID | 149111 |
mRNA Refseq | NM_152495 |
Protein Refseq | NP_689708 |
UniProt ID | Q8TBE1 |
◆ Cell & Tissue Lysates | ||
CNIH3-7408HCL | Recombinant Human CNIH3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CNIH3 Products
Required fields are marked with *
My Review for All CNIH3 Products
Required fields are marked with *