Recombinant Human CNOT6 Protein, GST-tagged
Cat.No. : | CNOT6-1584H |
Product Overview : | Human CNOT6 full-length ORF ( AAH27476.1, 1 a.a. - 92 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes the catalytic component of the CCR4-NOT core transcriptional regulation complex. The encoded protein has a 3'-5' RNase activity and prefers polyadenylated substrates. The CCR4-NOT complex plays a role in many cellular processes, including miRNA-mediated repression, mRNA degradation, and transcriptional regulation. [provided by RefSeq, Dec 2014] |
Molecular Mass : | 36.7 kDa |
AA Sequence : | MCIMTISSEGELELVGLMRLRKQLFLRSALCNHRSRELYGSGRGGALTHVVFVNGGCHLFIDAGTRVHLLDAKGLSFTQNVFICICYCLQYI |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CNOT6 CCR4-NOT transcription complex, subunit 6 [ Homo sapiens ] |
Official Symbol | CNOT6 |
Synonyms | CNOT6; CCR4-NOT transcription complex, subunit 6; CCR4-NOT transcription complex subunit 6; CCR4; KIAA1194; cytoplasmic deadenylase; carbon catabolite repression 4 protein; carbon catabolite repressor protein 4 homolog; |
Gene ID | 57472 |
mRNA Refseq | NM_015455 |
Protein Refseq | NP_056270 |
MIM | 608951 |
UniProt ID | Q9ULM6 |
◆ Recombinant Proteins | ||
CNOT6-2175H | Recombinant Human CNOT6 Protein (Leu153-Arg557), N-His tagged | +Inquiry |
CNOT6-1584H | Recombinant Human CNOT6 Protein, GST-tagged | +Inquiry |
CNOT6-1153R | Recombinant Rat CNOT6 Protein, His (Fc)-Avi-tagged | +Inquiry |
CNOT6-764R | Recombinant Rhesus Macaque CNOT6 Protein, His (Fc)-Avi-tagged | +Inquiry |
CNOT6-11936Z | Recombinant Zebrafish CNOT6 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CNOT6 Products
Required fields are marked with *
My Review for All CNOT6 Products
Required fields are marked with *
0
Inquiry Basket