Recombinant Human CNOT6 Protein, GST-tagged
| Cat.No. : | CNOT6-1584H |
| Product Overview : | Human CNOT6 full-length ORF ( AAH27476.1, 1 a.a. - 92 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes the catalytic component of the CCR4-NOT core transcriptional regulation complex. The encoded protein has a 3'-5' RNase activity and prefers polyadenylated substrates. The CCR4-NOT complex plays a role in many cellular processes, including miRNA-mediated repression, mRNA degradation, and transcriptional regulation. [provided by RefSeq, Dec 2014] |
| Molecular Mass : | 36.7 kDa |
| AA Sequence : | MCIMTISSEGELELVGLMRLRKQLFLRSALCNHRSRELYGSGRGGALTHVVFVNGGCHLFIDAGTRVHLLDAKGLSFTQNVFICICYCLQYI |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CNOT6 CCR4-NOT transcription complex, subunit 6 [ Homo sapiens ] |
| Official Symbol | CNOT6 |
| Synonyms | CNOT6; CCR4-NOT transcription complex, subunit 6; CCR4-NOT transcription complex subunit 6; CCR4; KIAA1194; cytoplasmic deadenylase; carbon catabolite repression 4 protein; carbon catabolite repressor protein 4 homolog; |
| Gene ID | 57472 |
| mRNA Refseq | NM_015455 |
| Protein Refseq | NP_056270 |
| MIM | 608951 |
| UniProt ID | Q9ULM6 |
| ◆ Recombinant Proteins | ||
| CNOT6-1495R | Recombinant Rat CNOT6 Protein | +Inquiry |
| CNOT6-3668M | Recombinant Mouse CNOT6 Protein | +Inquiry |
| CNOT6-1584H | Recombinant Human CNOT6 Protein, GST-tagged | +Inquiry |
| CNOT6-2174H | Recombinant Human CNOT6 Protein (153-557), His tagged | +Inquiry |
| CNOT6-939R | Recombinant Rhesus monkey CNOT6 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CNOT6 Products
Required fields are marked with *
My Review for All CNOT6 Products
Required fields are marked with *



