Recombinant Human CNOT8 Protein, GST-tagged
Cat.No. : | CNOT8-1589H |
Product Overview : | Human CNOT8 full-length ORF ( AAH17366, 1 a.a. - 292 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | CNOT8 (CCR4-NOT Transcription Complex Subunit 8) is a Protein Coding gene. Among its related pathways are Deadenylation-dependent mRNA decay and Gene Expression. GO annotations related to this gene include nucleic acid binding and RNA binding. An important paralog of this gene is CNOT7. |
Molecular Mass : | 57.86 kDa |
AA Sequence : | MPAALVENSQVICEVWASNLEEEMRKIREIVLSYSYIAMDTEFPGVVVRPIGEFRSSIDYQYQLLRCNVDLLKIIQLGLTFTNEKGEYPSGINTWQFNFKFNLTEDMYSQDSIDLLANSGLQFQKHEEEGIDTLHFAELLTTSGVVLCDNVKWLSFHSGYDFGYMVKLLTDSRLPEEEHEFFHILNLFFPSIYDVKYLMKSCKNLKGGLQEVADQLDLQRIGRQHQAGSDSLLTGMAFFRMKELFFEDSIDDAKYCGRLYGLGTGVAQKQNEDVDSAQEKMSILAIINNMQQ |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CNOT8 CCR4-NOT transcription complex, subunit 8 [ Homo sapiens ] |
Official Symbol | CNOT8 |
Synonyms | CNOT8; CCR4-NOT transcription complex, subunit 8; POP2; CCR4-NOT transcription complex subunit 8; CAF1; CALIF; hCAF1; PGK promoter directed over production; CAF2; CALIFp; CAF1-like protein; CCR4-associated factor 8; |
Gene ID | 9337 |
mRNA Refseq | NM_004779 |
Protein Refseq | NP_004770 |
MIM | 603731 |
UniProt ID | Q9UFF9 |
◆ Recombinant Proteins | ||
CNOT8-4829H | Recombinant Human CNOT8 protein, GST-tagged | +Inquiry |
CNOT8-2327C | Recombinant Chicken CNOT8 | +Inquiry |
CNOT8-156H | Recombinant Human CNOT8 protein, T7/His-tagged | +Inquiry |
CNOT8-207H | Recombinant Human CCR4-NOT transcription complex, subunit 8, His-tagged | +Inquiry |
CNOT8-942R | Recombinant Rhesus monkey CNOT8 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CNOT8-7398HCL | Recombinant Human CNOT8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CNOT8 Products
Required fields are marked with *
My Review for All CNOT8 Products
Required fields are marked with *
0
Inquiry Basket