Recombinant Human CNOT8 Protein, GST-tagged

Cat.No. : CNOT8-1589H
Product Overview : Human CNOT8 full-length ORF ( AAH17366, 1 a.a. - 292 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : CNOT8 (CCR4-NOT Transcription Complex Subunit 8) is a Protein Coding gene. Among its related pathways are Deadenylation-dependent mRNA decay and Gene Expression. GO annotations related to this gene include nucleic acid binding and RNA binding. An important paralog of this gene is CNOT7.
Molecular Mass : 57.86 kDa
AA Sequence : MPAALVENSQVICEVWASNLEEEMRKIREIVLSYSYIAMDTEFPGVVVRPIGEFRSSIDYQYQLLRCNVDLLKIIQLGLTFTNEKGEYPSGINTWQFNFKFNLTEDMYSQDSIDLLANSGLQFQKHEEEGIDTLHFAELLTTSGVVLCDNVKWLSFHSGYDFGYMVKLLTDSRLPEEEHEFFHILNLFFPSIYDVKYLMKSCKNLKGGLQEVADQLDLQRIGRQHQAGSDSLLTGMAFFRMKELFFEDSIDDAKYCGRLYGLGTGVAQKQNEDVDSAQEKMSILAIINNMQQ
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CNOT8 CCR4-NOT transcription complex, subunit 8 [ Homo sapiens ]
Official Symbol CNOT8
Synonyms CNOT8; CCR4-NOT transcription complex, subunit 8; POP2; CCR4-NOT transcription complex subunit 8; CAF1; CALIF; hCAF1; PGK promoter directed over production; CAF2; CALIFp; CAF1-like protein; CCR4-associated factor 8;
Gene ID 9337
mRNA Refseq NM_004779
Protein Refseq NP_004770
MIM 603731
UniProt ID Q9UFF9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CNOT8 Products

Required fields are marked with *

My Review for All CNOT8 Products

Required fields are marked with *

0
cart-icon