Recombinant Human CNRIP1 protein, GST-tagged
Cat.No. : | CNRIP1-1603H |
Product Overview : | Recombinant Human CNRIP1 protein(NP_056278)(1-164 aa), fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-164 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
AA Sequence : | MGDLPGLVRLSIALRIQPNDGPVFYKVDGQRFGQNRTIKLLTGSSYKVEVKIKPSTLQVENISIGGVLVPLELKSKEPDGDRVVYTGTYDTEGVTPTKSGERQPIQITMPFTDIGTFETVWQVKFYNYHKRDHCQWGSPFSVIEYECKPNETRSLMWVNKESFL |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | CNRIP1 cannabinoid receptor interacting protein 1 [ Homo sapiens ] |
Official Symbol | CNRIP1 |
Synonyms | CNRIP1; cannabinoid receptor interacting protein 1; C2orf32, chromosome 2 open reading frame 32; CB1 cannabinoid receptor-interacting protein 1; CRIP1; CRIP1a; CRIP1b; DKFZP566K1924; CRIP-1; cannabinoid receptor CB1-interacting protein 1; C2orf32; DKFZp566K1924; |
Gene ID | 25927 |
mRNA Refseq | NM_015463 |
Protein Refseq | NP_056278 |
UniProt ID | Q96F85 |
◆ Recombinant Proteins | ||
CNRIP1-1603H | Recombinant Human CNRIP1 protein, GST-tagged | +Inquiry |
CNRIP1-1960HF | Recombinant Full Length Human CNRIP1 Protein, GST-tagged | +Inquiry |
CNRIP1-4919C | Recombinant Chicken CNRIP1 | +Inquiry |
CNRIP1-1837H | Recombinant Human CNRIP1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CNRIP1-2073H | Recombinant Human CNRIP1 Protein (Gln34-Leu164), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CNRIP1-7393HCL | Recombinant Human CNRIP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CNRIP1 Products
Required fields are marked with *
My Review for All CNRIP1 Products
Required fields are marked with *