Recombinant Human CNRIP1 protein, GST-tagged
| Cat.No. : | CNRIP1-1603H |
| Product Overview : | Recombinant Human CNRIP1 protein(1-164 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-164 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | MGDLPGLVRLSIALRIQPNDGPVFYKVDGQRFGQNRTIKLLTGSSYKVEVKIKPSTLQVENISIGGVLVPLELKSKEPDGDRVVYTGTYDTEGVTPTKSGERQPIQITMPFTDIGTFETVWQVKFYNYHKRDHCQWGSPFSVIEYECKPNETRSLMWVNKESFL |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 12 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | CNRIP1 cannabinoid receptor interacting protein 1 [ Homo sapiens ] |
| Official Symbol | CNRIP1 |
| Synonyms | CNRIP1; cannabinoid receptor interacting protein 1; C2orf32, chromosome 2 open reading frame 32; CB1 cannabinoid receptor-interacting protein 1; CRIP1; CRIP1a; CRIP1b; DKFZP566K1924; CRIP-1; cannabinoid receptor CB1-interacting protein 1; C2orf32; DKFZp566K1924; |
| Gene ID | 25927 |
| mRNA Refseq | NM_015463 |
| Protein Refseq | NP_056278 |
| UniProt ID | Q96F85 |
| ◆ Recombinant Proteins | ||
| CNRIP1-1499R | Recombinant Rat CNRIP1 Protein | +Inquiry |
| Cnrip1-2226M | Recombinant Mouse Cnrip1 Protein, Myc/DDK-tagged | +Inquiry |
| CNRIP1-1960HF | Recombinant Full Length Human CNRIP1 Protein, GST-tagged | +Inquiry |
| CNRIP1-4919C | Recombinant Chicken CNRIP1 | +Inquiry |
| CNRIP1-1603H | Recombinant Human CNRIP1 protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CNRIP1-7393HCL | Recombinant Human CNRIP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CNRIP1 Products
Required fields are marked with *
My Review for All CNRIP1 Products
Required fields are marked with *
