Recombinant Human CNRIP1 protein, GST-tagged

• Cat.No.: CNRIP1-1603H
• Product Overview: Recombinant Human CNRIP1 protein(NP_056278)(1-164 aa), fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-164 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.
• AA Sequence: MGDLPGLVRLSIALRIQPNDGPVFYKVDGQRFGQNRTIKLLTGSSYKVEVKIKPSTLQVENISIGGVLVPLELKSKEPDGDRVVYTGTYDTEGVTPTKSGERQPIQITMPFTDIGTFETVWQVKFYNYHKRDHCQWGSPFSVIEYECKPNETRSLMWVNKESFL
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: CNRIP1 cannabinoid receptor interacting protein 1 [ Homo sapiens ]
• Official Symbol: CNRIP1
• Synonyms: CNRIP1; cannabinoid receptor interacting protein 1; C2orf32, chromosome 2 open reading frame 32; CB1 cannabinoid receptor-interacting protein 1; CRIP1; CRIP1a; CRIP1b; DKFZP566K1924; CRIP-1; cannabinoid receptor CB1-interacting protein 1; C2orf32; DKFZp566K1924
• Gene ID: 25927
• mRNA Refseq: NM_015463
• Protein Refseq: NP_056278
• UniProt ID: Q96F85