Recombinant Human CNTD2 Protein, GST-tagged

Cat.No. : CNTD2-1604H
Product Overview : Human CNTD2 full-length ORF (BAB14529.1, 1 a.a. - 155 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : CNTD2 (Cyclin N-Terminal Domain Containing 2) is a Protein Coding gene. GO annotations related to this gene include protein kinase binding.
Molecular Mass : 43.1 kDa
AA Sequence : MLVRGRDQGSGSRLGPIVRRWAPRPSPLQSLAASLDAEPSSAAVPDGFPAGPTVSPRRLARPPGLEEALSALGLQGEREYAGDIFAEVMEYLGLAGDTLYLAVHLLDSYLSAGRVRLHRLQLLGVACLFVACKMEECVLPEETEVRNLGPFQGRE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CNTD2 cyclin N-terminal domain containing 2 [ Homo sapiens ]
Official Symbol CNTD2
Synonyms CNTD2; cyclin N-terminal domain containing 2; cyclin N-terminal domain-containing protein 2; FLJ13265;
Gene ID 79935
mRNA Refseq NM_024877
Protein Refseq NP_079153
UniProt ID Q9H8S5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CNTD2 Products

Required fields are marked with *

My Review for All CNTD2 Products

Required fields are marked with *

0
cart-icon
0
compare icon