Recombinant Human CNTF protein

Cat.No. : CNTF-36H
Product Overview : Recombinant Human CNTF protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 200
Description : Ciliary neurotrophic factor (CNTF) is a polypeptide hormone whose actions appear to be restricted to the nervous system where it promotes neurotransmitter synthesis and neurite outgrowth in certain neuronal populations. It was initially identified as a trophic factor for embryonic chick ciliary parasympathetic neurons in culture. The protein is also a potent survival factor for neurons and oligodendrocytes and may be relevant in reducing tissue destruction during inflammatory attacks. In addition, CNTF is useful for treatment of motor neuron disease and it could reduce food intake without causing hunger or stress. CNTF is structurally related to IL-6, IL-11, LIF and OSM. All of these four helix bundle cytokines share gp130 as a signal-transducing subunit in their receptor complexes. Recombinant human CNTF containing 200 amino acids and it shares 82 % and 83 % a.a. sequence identity with mouse and rat CNTF.
Form : Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4.
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human TF-1 cells is less than 150 ng/ml, corresponding to a specific activity of > 6.7 × 10³ IU/mg.
Molecular Mass : Approximately 22.9 kDa, a single non-glycosylated polypeptide chain containing 200 amino acids.
AA Sequence : MAFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIANNKKM
Endotoxin : Less than 1 EU/μg of rHuCNTF as determined by LAL method.
Purity : >97% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name CNTF
Official Symbol CNTF
Synonyms CNTF; ciliary neurotrophic factor; HCNTF;
Gene ID 1270
mRNA Refseq NM_000614
Protein Refseq NP_000605
MIM 118945
UniProt ID P26441

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CNTF Products

Required fields are marked with *

My Review for All CNTF Products

Required fields are marked with *

0
cart-icon
0
compare icon