Recombinant Human CNTLN Protein, GST-tagged
Cat.No. : | CNTLN-5166H |
Product Overview : | Human C9orf39 partial ORF ( NP_060208, 971 a.a. - 1070 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | CNTLN (Centlein) is a Protein Coding gene. Diseases associated with CNTLN include Seckel Syndrome 1 and Meesmann Corneal Dystrophy. GO annotations related to this gene include protein kinase binding and protein binding, bridging. |
Molecular Mass : | 36.74 kDa |
AA Sequence : | QNDVHVVRRQIRELKKMKKNRDACKTSTHKAQTLAASILNISRSDLEEILDTEDQVEIEKTKIDAENDKEWMLYIQKLLEGQSLALSPRLKCNGAIMAHQ |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CNTLN centlein [ Homo sapiens (human) ] |
Official Symbol | CNTLN |
Synonyms | CNTLN; centlein; C9orf39; C9orf101; bA340N12.1; centlein; centlein, centrosomal protein; centrosomal protein |
Gene ID | 54875 |
mRNA Refseq | NM_001114395 |
Protein Refseq | NP_001107867 |
MIM | 611870 |
UniProt ID | Q9NXG0 |
◆ Recombinant Proteins | ||
CNTLN-3684M | Recombinant Mouse CNTLN Protein | +Inquiry |
CNTLN-1159R | Recombinant Rat CNTLN Protein, His (Fc)-Avi-tagged | +Inquiry |
CNTLN-1502R | Recombinant Rat CNTLN Protein | +Inquiry |
CNTLN-1828M | Recombinant Mouse CNTLN Protein, His (Fc)-Avi-tagged | +Inquiry |
CNTLN-5166H | Recombinant Human CNTLN Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CNTLN Products
Required fields are marked with *
My Review for All CNTLN Products
Required fields are marked with *