Recombinant Human CNTN2 Protein, GST-tagged

Cat.No. : CNTN2-1608H
Product Overview : Human CNTN2 partial ORF ( NP_005067, 825 a.a. - 923 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the contactin family of proteins, part of the immunoglobulin superfamily of cell adhesion molecules. The encoded glycosylphosphatidylinositol (GPI)-anchored neuronal membrane protein plays a role in the proliferation, migration, and axon guidance of neurons of the developing cerebellum. A mutation in this gene may be associated with adult myoclonic epilepsy. [provided by RefSeq, Sep 2016]
Molecular Mass : 36.63 kDa
AA Sequence : SSSEMNVTWEPVQQDMNGILLGYEIRYWKAGDKEAAADRVRTAGLDTSARVSGLHPNTKYHVTVRAYNRAGTGPASPSANATTMKPPPRRPPGNISWTF
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CNTN2 contactin 2 (axonal) [ Homo sapiens ]
Official Symbol CNTN2
Synonyms CNTN2; contactin 2 (axonal); AXT, TAX; contactin-2; TAG 1; TAX1; TAX-1; axonal glycoprotein TAG-1; axonin-1 cell adhesion molecule; transient axonal glycoprotein 1; contactin 2 (transiently expressed); transiently-expressed axonal glycoprotein; AXT; TAX; TAG-1; FLJ37193; FLJ42746; MGC157722; DKFZp781D102;
Gene ID 6900
mRNA Refseq NM_005076
Protein Refseq NP_005067
MIM 190197
UniProt ID Q02246

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CNTN2 Products

Required fields are marked with *

My Review for All CNTN2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon