Recombinant Human CNTN2 Protein, GST-tagged
| Cat.No. : | CNTN2-1608H |
| Product Overview : | Human CNTN2 partial ORF ( NP_005067, 825 a.a. - 923 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a member of the contactin family of proteins, part of the immunoglobulin superfamily of cell adhesion molecules. The encoded glycosylphosphatidylinositol (GPI)-anchored neuronal membrane protein plays a role in the proliferation, migration, and axon guidance of neurons of the developing cerebellum. A mutation in this gene may be associated with adult myoclonic epilepsy. [provided by RefSeq, Sep 2016] |
| Molecular Mass : | 36.63 kDa |
| AA Sequence : | SSSEMNVTWEPVQQDMNGILLGYEIRYWKAGDKEAAADRVRTAGLDTSARVSGLHPNTKYHVTVRAYNRAGTGPASPSANATTMKPPPRRPPGNISWTF |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CNTN2 contactin 2 (axonal) [ Homo sapiens ] |
| Official Symbol | CNTN2 |
| Synonyms | CNTN2; contactin 2 (axonal); AXT, TAX; contactin-2; TAG 1; TAX1; TAX-1; axonal glycoprotein TAG-1; axonin-1 cell adhesion molecule; transient axonal glycoprotein 1; contactin 2 (transiently expressed); transiently-expressed axonal glycoprotein; AXT; TAX; TAG-1; FLJ37193; FLJ42746; MGC157722; DKFZp781D102; |
| Gene ID | 6900 |
| mRNA Refseq | NM_005076 |
| Protein Refseq | NP_005067 |
| MIM | 190197 |
| UniProt ID | Q02246 |
| ◆ Recombinant Proteins | ||
| CNTN2-2705H | Recombinant Human CNTN2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CNTN2-2819H | Recombinant Human CNTN2 protein(611-810 aa), N-SUMO & C-His-tagged | +Inquiry |
| Cntn2-5809M | Recombinant Mouse Cntn2 protein, His & T7-tagged | +Inquiry |
| CNTN2-383H | Recombinant Human CNTN2 | +Inquiry |
| CNTN2-776R | Recombinant Rhesus Macaque CNTN2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CNTN2-1518MCL | Recombinant Mouse CNTN2 cell lysate | +Inquiry |
| CNTN2-3035HCL | Recombinant Human CNTN2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CNTN2 Products
Required fields are marked with *
My Review for All CNTN2 Products
Required fields are marked with *
