Recombinant Human CNTN2 Protein, GST-tagged

• Cat.No.: CNTN2-1608H
• Product Overview: Human CNTN2 partial ORF ( NP_005067, 825 a.a. - 923 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a member of the contactin family of proteins, part of the immunoglobulin superfamily of cell adhesion molecules. The encoded glycosylphosphatidylinositol (GPI)-anchored neuronal membrane protein plays a role in the proliferation, migration, and axon guidance of neurons of the developing cerebellum. A mutation in this gene may be associated with adult myoclonic epilepsy. [provided by RefSeq, Sep 2016]
• Molecular Mass: 36.63 kDa
• AA Sequence: SSSEMNVTWEPVQQDMNGILLGYEIRYWKAGDKEAAADRVRTAGLDTSARVSGLHPNTKYHVTVRAYNRAGTGPASPSANATTMKPPPRRPPGNISWTF
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CNTN2 contactin 2 (axonal) [ Homo sapiens ]
• Official Symbol: CNTN2
• Synonyms: CNTN2; contactin 2 (axonal); AXT, TAX; contactin-2; TAG 1; TAX1; TAX-1; axonal glycoprotein TAG-1; axonin-1 cell adhesion molecule; transient axonal glycoprotein 1; contactin 2 (transiently expressed); transiently-expressed axonal glycoprotein; AXT; TAX; TAG-1; FLJ37193; FLJ42746; MGC157722; DKFZp781D102
• Gene ID: 6900
• mRNA Refseq: NM_005076
• Protein Refseq: NP_005067
• MIM: 190197
• UniProt ID: Q02246