Recombinant Human CNTN2 Protein, GST-tagged
Cat.No. : | CNTN2-1608H |
Product Overview : | Human CNTN2 partial ORF ( NP_005067, 825 a.a. - 923 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the contactin family of proteins, part of the immunoglobulin superfamily of cell adhesion molecules. The encoded glycosylphosphatidylinositol (GPI)-anchored neuronal membrane protein plays a role in the proliferation, migration, and axon guidance of neurons of the developing cerebellum. A mutation in this gene may be associated with adult myoclonic epilepsy. [provided by RefSeq, Sep 2016] |
Molecular Mass : | 36.63 kDa |
AA Sequence : | SSSEMNVTWEPVQQDMNGILLGYEIRYWKAGDKEAAADRVRTAGLDTSARVSGLHPNTKYHVTVRAYNRAGTGPASPSANATTMKPPPRRPPGNISWTF |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CNTN2 contactin 2 (axonal) [ Homo sapiens ] |
Official Symbol | CNTN2 |
Synonyms | CNTN2; contactin 2 (axonal); AXT, TAX; contactin-2; TAG 1; TAX1; TAX-1; axonal glycoprotein TAG-1; axonin-1 cell adhesion molecule; transient axonal glycoprotein 1; contactin 2 (transiently expressed); transiently-expressed axonal glycoprotein; AXT; TAX; TAG-1; FLJ37193; FLJ42746; MGC157722; DKFZp781D102; |
Gene ID | 6900 |
mRNA Refseq | NM_005076 |
Protein Refseq | NP_005067 |
MIM | 190197 |
UniProt ID | Q02246 |
◆ Recombinant Proteins | ||
CNTN2-020H | Recombinant Human CNTN2 protein, His-tagged | +Inquiry |
CNTN2-1161R | Recombinant Rat CNTN2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CNTN2-383H | Recombinant Human CNTN2 | +Inquiry |
CNTN2-1608H | Recombinant Human CNTN2 Protein, GST-tagged | +Inquiry |
Cntn2-7425M | Recombinant Mouse Cntn2 protein(Gln31-Glu1013), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CNTN2-3035HCL | Recombinant Human CNTN2 cell lysate | +Inquiry |
CNTN2-1518MCL | Recombinant Mouse CNTN2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CNTN2 Products
Required fields are marked with *
My Review for All CNTN2 Products
Required fields are marked with *