Recombinant Human COA3 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: COA3-512H
• Product Overview: CCDC56 MS Standard C13 and N15-labeled recombinant protein (NP_001035521) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes a member of the cytochrome c oxidase assembly factor family. Studies of a related gene in fly suggest that the encoded protein is localized to mitochondria and is essential for cytochrome c oxidase function.
• Molecular Mass: 11.7 kDa
• AA Sequence: MASSGAGDPLDSKRGEAPFAQRIDPTREKLTPEQLHSMRQAELAQWQKVLPRRRTRNIVTGLGIGALVLAIYGYTFYSISQERFLDELEDEAKAARARALARASGSTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: COA3 cytochrome c oxidase assembly factor 3 [ Homo sapiens (human) ]
• Official Symbol: COA3
• Synonyms: CCDC56; HSPC009; MITRAC12; cytochrome c oxidase assembly protein 3 homolog, mitochondrial; coiled-coil domain-containing protein 56; cytochrome C oxidase assembly factor 3 homolog, mitochondrial; mitochondrial translation regulation assembly intermediate of cytochrome c oxidase protein of 12 kDa; COA3
• Gene ID: 28958
• mRNA Refseq: NM_001040431
• Protein Refseq: NP_001035521
• MIM: 614775
• UniProt ID: Q9Y2R0