Recombinant Human COA3 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | COA3-512H |
Product Overview : | CCDC56 MS Standard C13 and N15-labeled recombinant protein (NP_001035521) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a member of the cytochrome c oxidase assembly factor family. Studies of a related gene in fly suggest that the encoded protein is localized to mitochondria and is essential for cytochrome c oxidase function. |
Molecular Mass : | 11.7 kDa |
AA Sequence : | MASSGAGDPLDSKRGEAPFAQRIDPTREKLTPEQLHSMRQAELAQWQKVLPRRRTRNIVTGLGIGALVLAIYGYTFYSISQERFLDELEDEAKAARARALARASGSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | COA3 cytochrome c oxidase assembly factor 3 [ Homo sapiens (human) ] |
Official Symbol | COA3 |
Synonyms | CCDC56; HSPC009; MITRAC12; cytochrome c oxidase assembly protein 3 homolog, mitochondrial; coiled-coil domain-containing protein 56; cytochrome C oxidase assembly factor 3 homolog, mitochondrial; mitochondrial translation regulation assembly intermediate of cytochrome c oxidase protein of 12 kDa; COA3 |
Gene ID | 28958 |
mRNA Refseq | NM_001040431 |
Protein Refseq | NP_001035521 |
MIM | 614775 |
UniProt ID | Q9Y2R0 |
◆ Cell & Tissue Lysates | ||
COA3-7759HCL | Recombinant Human CCDC56 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All COA3 Products
Required fields are marked with *
My Review for All COA3 Products
Required fields are marked with *