Recombinant Human COA3 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : COA3-512H
Product Overview : CCDC56 MS Standard C13 and N15-labeled recombinant protein (NP_001035521) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a member of the cytochrome c oxidase assembly factor family. Studies of a related gene in fly suggest that the encoded protein is localized to mitochondria and is essential for cytochrome c oxidase function.
Molecular Mass : 11.7 kDa
AA Sequence : MASSGAGDPLDSKRGEAPFAQRIDPTREKLTPEQLHSMRQAELAQWQKVLPRRRTRNIVTGLGIGALVLAIYGYTFYSISQERFLDELEDEAKAARARALARASGSTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name COA3 cytochrome c oxidase assembly factor 3 [ Homo sapiens (human) ]
Official Symbol COA3
Synonyms CCDC56; HSPC009; MITRAC12; cytochrome c oxidase assembly protein 3 homolog, mitochondrial; coiled-coil domain-containing protein 56; cytochrome C oxidase assembly factor 3 homolog, mitochondrial; mitochondrial translation regulation assembly intermediate of cytochrome c oxidase protein of 12 kDa; COA3
Gene ID 28958
mRNA Refseq NM_001040431
Protein Refseq NP_001035521
MIM 614775
UniProt ID Q9Y2R0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All COA3 Products

Required fields are marked with *

My Review for All COA3 Products

Required fields are marked with *

0
cart-icon
0
compare icon