Recombinant Human COG6 Protein, GST-tagged

Cat.No. : COG6-1629H
Product Overview : Human COG6 partial ORF ( NP_065802, 558 a.a. - 657 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a subunit of the conserved oligomeric Golgi complex that is required for maintaining normal structure and activity of the Golgi apparatus. The encoded protein is organized with conserved oligomeric Golgi complex components 5, 7 and 8 into a sub-complex referred to as lobe B. Alternative splicing results in multiple transcript variants.[provided by RefSeq, Feb 2009]
Molecular Mass : 36.74 kDa
AA Sequence : QQHKPEQGSLANMPNLDSVTLKAAMVQFDRYLSAPDNLLIPQLNFLLSATVKEQIVKQSTELVCRAYGEVYAAVMNPINEYKDPENILHRSPQQVQTLLS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name COG6 component of oligomeric golgi complex 6 [ Homo sapiens ]
Official Symbol COG6
Synonyms COG6; component of oligomeric golgi complex 6; conserved oligomeric Golgi complex subunit 6; COD2; KIAA1134; COG complex subunit 6; complexed with Dor1p 2; conserved oligomeric Golgi complex protein 6; DKFZp313D191;
Gene ID 57511
mRNA Refseq NM_001145079
Protein Refseq NP_001138551
MIM 606977
UniProt ID Q9Y2V7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All COG6 Products

Required fields are marked with *

My Review for All COG6 Products

Required fields are marked with *

0
cart-icon
0
compare icon