Recombinant Human COL11A1 protein, His-GST-tagged

Cat.No. : COL11A1-4253H
Product Overview : Recombinant Human COL11A1 protein(P12107)(532-699aa), fused with N-terminal His and GST tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST&His
Protein Length : 532-699aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 47.3 kDa
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : GPMGLTGRPGPVGGPGSSGAKGESGDPGPQGPRGVQGPPGPTGKPGKRGRPGADGGRGMPGEPGAKGDRGFDGLPGLPGDKGHRGERGPQGPPGPPGDDGMRGEDGEIGPRGLPGEAGPRGLLGPRGTPGAPGQPGMAGVDGPPGPKGNMGPQGEPGPPGQQGNPGPQ
Gene Name COL11A1 collagen, type XI, alpha 1 [ Homo sapiens ]
Official Symbol COL11A1
Synonyms COL11A1; collagen, type XI, alpha 1; COLL6; collagen alpha-1(XI) chain; CO11A1; collagen XI; alpha 1 polypeptide; STL2; collagen XI, alpha-1 polypeptide;
Gene ID 1301
mRNA Refseq NM_001190709
Protein Refseq NP_001177638
MIM 120280
UniProt ID P12107

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All COL11A1 Products

Required fields are marked with *

My Review for All COL11A1 Products

Required fields are marked with *

0
cart-icon
0
compare icon