Recombinant Human COL11A1 protein, His-GST-tagged
| Cat.No. : | COL11A1-4253H |
| Product Overview : | Recombinant Human COL11A1 protein(P12107)(532-699aa), fused with N-terminal His and GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST&His |
| Protein Length : | 532-699aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 47.3 kDa |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | GPMGLTGRPGPVGGPGSSGAKGESGDPGPQGPRGVQGPPGPTGKPGKRGRPGADGGRGMPGEPGAKGDRGFDGLPGLPGDKGHRGERGPQGPPGPPGDDGMRGEDGEIGPRGLPGEAGPRGLLGPRGTPGAPGQPGMAGVDGPPGPKGNMGPQGEPGPPGQQGNPGPQ |
| Gene Name | COL11A1 collagen, type XI, alpha 1 [ Homo sapiens ] |
| Official Symbol | COL11A1 |
| Synonyms | COL11A1; collagen, type XI, alpha 1; COLL6; collagen alpha-1(XI) chain; CO11A1; collagen XI; alpha 1 polypeptide; STL2; collagen XI, alpha-1 polypeptide; |
| Gene ID | 1301 |
| mRNA Refseq | NM_001190709 |
| Protein Refseq | NP_001177638 |
| MIM | 120280 |
| UniProt ID | P12107 |
| ◆ Recombinant Proteins | ||
| COL11A1-4253H | Recombinant Human COL11A1 protein, His-GST-tagged | +Inquiry |
| COL11A1-1516R | Recombinant Rat COL11A1 Protein | +Inquiry |
| COL11A1-15H | Recombinant Human COL11A1 protein, His-tagged | +Inquiry |
| COL11A1-1173R | Recombinant Rat COL11A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| COL11A1-2792H | Recombinant Human COL11A1 Protein, His-tagged, OVA Conjugated | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All COL11A1 Products
Required fields are marked with *
My Review for All COL11A1 Products
Required fields are marked with *
